PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK25283.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 70aa MW: 8486.23 Da PI: 10.1075 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.5 | 7.6e-19 | 2 | 47 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l ++v+q+G +W++Ia+++ gR++k+c++rw++ PK25283.1 2 RGHWRPAEDEKLRQLVEQYGAQNWNSIAEKLH-GRSGKSCRLRWFNQ 47 899*****************************.***********996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 2.2E-14 | 1 | 50 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 26.599 | 1 | 52 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-29 | 3 | 66 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.12E-20 | 3 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.46E-12 | 5 | 46 | No hit | No description |
Pfam | PF13921 | 6.7E-19 | 5 | 65 | No hit | No description |
PROSITE profile | PS51294 | 7.338 | 53 | 70 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 70 aa Download sequence Send to blast |
XRGHWRPAED EKLRQLVEQY GAQNWNSIAE KLHGRSGKSC RLRWFNQLDP RINRRPFTEE 60 EEERLLAAHR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-16 | 2 | 70 | 7 | 75 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021284864.1 | 1e-42 | trichome differentiation protein GL1-like | ||||
Swissprot | Q6R0C4 | 1e-38 | MYB52_ARATH; Transcription factor MYB52 | ||||
TrEMBL | A0A2Z6MY72 | 1e-41 | A0A2Z6MY72_TRISU; Uncharacterized protein | ||||
STRING | EOY16562 | 4e-42 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF230 | 34 | 243 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G17950.1 | 6e-37 | myb domain protein 52 |
Publications ? help Back to Top | |||
---|---|---|---|
|