PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK23594.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 136aa MW: 16065.2 Da PI: 11.3755 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.9 | 9.6e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+ Ed llv++++++G g+W+ ++++ g+ R++k+c++rw +yl PK23594.1 14 RGPWTPREDTLLVNYIQLHGEGHWRIVPKKAGLLRCGKSCRLRWMNYL 61 89******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 53.8 | 4.6e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ T++Ed+l+++++ +lG++ W++Ia +++ gRt++++k++w+++l PK23594.1 67 RGNITADEDDLIIRLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 112 7999******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.296 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.03E-31 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.2E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.3E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.9E-24 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.55E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 26.164 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 8.0E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.2E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-26 | 69 | 116 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.75E-11 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
MGRTACCSRF GLRRGPWTPR EDTLLVNYIQ LHGEGHWRIV PKKAGLLRCG KSCRLRWMNY 60 LRPDIKRGNI TADEDDLIIR LHSLLGNRWS LIAGRLPGRT DNEIKNYWNS HLSKRLNTNN 120 KERTKKKQQR QQQQQX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-28 | 12 | 118 | 5 | 110 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015896010.1 | 8e-76 | myb-related protein 308-like | ||||
Swissprot | Q7XBH4 | 9e-61 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
TrEMBL | A2Q125 | 4e-82 | A2Q125_HUMLU; Putative transcription factor | ||||
STRING | evm.model.supercontig_96.57 | 2e-74 | (Carica papaya) | ||||
STRING | POPTR_0001s11100.1 | 3e-74 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13540.1 | 5e-62 | myb domain protein 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|