PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK22855.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 219aa MW: 24758.6 Da PI: 9.2553 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.1 | 8.3e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W++eEde+l++++ +G g+W+++++ g+ R++k+c++rw +yl PK22855.1 14 RGLWSPEEDEKLINYISTYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61 788*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 51 | 3.4e-16 | 67 | 109 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 rg+++++E l++++++ lG++ W+ Ia++++ gRt++++k++w+ PK22855.1 67 RGSFSPQEAALIIELHTILGNR-WAQIAKHLP-GRTDNEVKNFWN 109 899*******************.*********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.8E-27 | 6 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.595 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.12E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.9E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.59E-13 | 17 | 61 | No hit | No description |
PROSITE profile | PS51294 | 24.93 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.3E-25 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.4E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.6E-14 | 67 | 110 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.37E-11 | 69 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009834 | Biological Process | plant-type secondary cell wall biogenesis | ||||
GO:0009901 | Biological Process | anther dehiscence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 219 aa Download sequence Send to blast |
MGHHSCCNKQ KVKRGLWSPE EDEKLINYIS TYGHGCWSSV PKLAGLQRCG KSCRLRWINY 60 LRPDLKRGSF SPQEAALIIE LHTILGNRWA QIAKHLPGRT DNEVKNFWNS SIKKKLLSGH 120 DNHLHHHHHI IPAAALTSFS DHIHFPNTIT PSAFSGDHYH NHDQTTSLFT FTAGSNPNNN 180 ILTSHQSQPN HHEQQQLYLP IINPTATSLV GTTTQGLFX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-31 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269|PubMed:12753590, ECO:0000269|PubMed:17147638, ECO:0000269|PubMed:17329564}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by auxin. {ECO:0000269|PubMed:23410518}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010087725.1 | 2e-93 | transcription factor MYB26 | ||||
Swissprot | Q9SPG3 | 1e-79 | MYB26_ARATH; Transcription factor MYB26 | ||||
TrEMBL | A0A2P5BE92 | 1e-106 | A0A2P5BE92_PARAD; MYB transcription factor | ||||
STRING | XP_010087725.1 | 9e-93 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3014 | 31 | 68 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13890.2 | 8e-86 | myb domain protein 26 |
Publications ? help Back to Top | |||
---|---|---|---|
|