PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK22181.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 72aa MW: 7982.09 Da PI: 10.7816 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 31.4 | 3.5e-10 | 3 | 32 | 60 | 90 |
EE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS B3 60 vltkGWkeFvkangLkegDfvvFkldgrsef 90 +++GWk Fv++n+Lk+gD++ F + + s + PK22181.1 3 RIESGWKAFVQDNDLKVGDVCAFVFRK-SIG 32 5789*******************9755.444 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 11.025 | 1 | 44 | IPR003340 | B3 DNA binding domain |
CDD | cd10017 | 3.64E-9 | 2 | 41 | No hit | No description |
SuperFamily | SSF101936 | 5.89E-10 | 3 | 45 | IPR015300 | DNA-binding pseudobarrel domain |
Gene3D | G3DSA:2.40.330.10 | 2.8E-9 | 3 | 44 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 2.3E-7 | 4 | 30 | IPR003340 | B3 DNA binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 72 aa Download sequence Send to blast |
XFRIESGWKA FVQDNDLKVG DVCAFVFRKS IGRILFEVVI FHNNGVANSP MAMLPIPAAN 60 KRSSTTPSKP KI |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF14300 | 4 | 16 |