PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK21701.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 151aa MW: 17362.6 Da PI: 10.2187 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 76.8 | 1.7e-24 | 35 | 78 | 2 | 45 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 r e+ snrqvt+skRrngilKKA+ELS+LCd+++a+++fs++gk PK21701.1 35 RLESISNRQVTYSKRRNGILKKAKELSILCDIDIALLMFSPSGK 78 67999*************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 23.885 | 26 | 86 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.3E-27 | 26 | 85 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.28E-26 | 27 | 120 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.0E-20 | 28 | 48 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.1E-22 | 37 | 80 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.0E-20 | 48 | 63 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.0E-20 | 63 | 84 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 151 aa Download sequence Send to blast |
XLVGFAQSKY RDCSLTHRQN FLPPQDGKLK LKIQRLESIS NRQVTYSKRR NGILKKAKEL 60 SILCDIDIAL LMFSPSGKPT LYQGERSNFE EVITKFSQLT CQERAKRKLE SLEALKKTFK 120 KLDHDVNIPD FMGSSSQTIE DSMSQVRVLQ X |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-15 | 27 | 117 | 2 | 90 | MEF2 CHIMERA |
6byy_B | 2e-15 | 27 | 117 | 2 | 90 | MEF2 CHIMERA |
6byy_C | 2e-15 | 27 | 117 | 2 | 90 | MEF2 CHIMERA |
6byy_D | 2e-15 | 27 | 117 | 2 | 90 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024019573.1 | 1e-65 | agamous-like MADS-box protein AGL65 isoform X1 | ||||
Refseq | XP_024019574.1 | 1e-65 | agamous-like MADS-box protein AGL65 isoform X2 | ||||
Swissprot | Q7X9I0 | 1e-57 | AGL65_ARATH; Agamous-like MADS-box protein AGL65 | ||||
TrEMBL | A0A067EKC3 | 4e-65 | A0A067EKC3_CITSI; Uncharacterized protein (Fragment) | ||||
TrEMBL | A0A218VXH5 | 1e-64 | A0A218VXH5_PUNGR; Uncharacterized protein | ||||
TrEMBL | A0A2P5F713 | 7e-65 | A0A2P5F713_TREOI; MADS-box transcription factor | ||||
STRING | XP_006477467.1 | 1e-62 | (Citrus sinensis) | ||||
STRING | EMJ11778 | 2e-63 | (Prunus persica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2750 | 33 | 70 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G18750.1 | 6e-60 | AGAMOUS-like 65 |
Publications ? help Back to Top | |||
---|---|---|---|
|