PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PK20358.1

Organism

Cannabis sativa

Taxonomic ID

3483

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

MYB

Protein Properties

Length: 223aa MW: 26260.8 Da PI: 4.9093

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK20358.1	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59.2	9.4e-19	5	52	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+ +++++G g+W++ ++ g+ R++k+c++rw +yl PK20358.1 5 KGPWTPEEDQILISYIHKYGHGNWRALPKLAGLLRCGKSCRLRWINYL 52 79****************************99**********97 PP
2	Myb_DNA-binding	56.2	8.1e-18	58	103	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+eE+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l PK20358.1 58 RGNFTKEEEETIIELHQMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 103 89******************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	1.59E-32	1	99	IPR009057	Homeodomain-like
PROSITE profile	PS51294	26.85	1	56	IPR017930	Myb domain
SMART	SM00717	1.6E-15	4	54	IPR001005	SANT/Myb domain
Pfam	PF00249	1.1E-17	5	52	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.6E-26	6	59	IPR009057	Homeodomain-like
CDD	cd00167	1.70E-11	7	52	No hit	No description
SMART	SM00717	1.3E-15	57	105	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	21.378	57	107	IPR017930	Myb domain
Pfam	PF00249	1.2E-16	58	103	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.5E-27	60	107	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 223 aa Download sequence Send to blast
MGLKKGPWTP EEDQILISYI HKYGHGNWRA LPKLAGLLRC GKSCRLRWIN YLRPDIKRGN 60 FTKEEEETII ELHQMLGNRW SAIAARLPGR TDNEIKNVWH THLKKRLIIN NNDDVIIQKS 120 KRQRNHESYD DDNNIKIDDT KYDNDNNSNN DNLVVSSPPQ SSSSYDSFIS TDDQKFSETM 180 DDQFWTEVFS SESDENDHNN HEFDFTLTNS NNNVDYDQDM EFW

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	7e-30	3	107	5	108	B-MYB
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	118	123	KSKRQR

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that regulates freezing tolerance by affecting expression of CBF genes. {ECO:0000269\|PubMed:24415840}.
UniProt	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269\|PubMed:17015446, ECO:0000269\|PubMed:19161942}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269\|PubMed:19161942}.
UniProt	INDUCTION: Induced by salicylic acid (SA), jasmonic acid (JA), salt (NaCl), ethylene and auxin (IAA) (PubMed:16463103). Down-regulated by cold treatment (PubMed:24415840). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:24415840}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015891267.1	1e-78	transcription factor MYB13
Swissprot	Q9LTC4	5e-73	MYB15_ARATH; Transcription factor MYB15
Swissprot	Q9SJX8	2e-73	MYB14_ARATH; Transcription factor MYB14
TrEMBL	A0A2P5E859	1e-78	A0A2P5E859_TREOI; MYB transcription factor
STRING	XP_004162391.1	2e-77	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G31180.1	1e-69	myb domain protein 14

Publications ? help Back to Top
Schnaubelt D, et al. Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana. Plant Cell Environ., 2015. 38(2): p. 266-79 [PMID:24329757] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Chen Y, et al. AtMYB14 Regulates Cold Tolerance in Arabidopsis. Plant Mol. Biol. Rep., 2013. 31: p. 87-97 [PMID:24415840] Ma X, et al. CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana. Plant Mol. Biol., 2015. 88(3): p. 287-99 [PMID:25948280] Kim SH, et al. Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis. Nucleic Acids Res., 2017. 45(11): p. 6613-6627 [PMID:28510716] Chezem WR,Memon A,Li FS,Weng JK,Clay NK SG2-Type R2R3-MYB Transcription Factor MYB15 Controls Defense-Induced Lignification and Basal Immunity in Arabidopsis. Plant Cell, 2017. 29(8): p. 1907-1926 [PMID:28733420] Pal S, et al. TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation. Plant Physiol., 2017. 175(2): p. 916-926 [PMID:28827455]