PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK19116.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 74aa MW: 8528.33 Da PI: 4.0537 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 32.1 | 2.1e-10 | 2 | 40 | 60 | 98 |
EE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS B3 60 vltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 v+ +GW+eF +n+L++gD+++F+l +r e l+v+++r PK19116.1 2 VIYDGWNEFMTENDLEVGDVCIFELLNRAEIVLYVSIVR 40 6789********************999888889999887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 11.251 | 1 | 42 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 1.73E-9 | 2 | 41 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 4.8E-8 | 2 | 40 | IPR003340 | B3 DNA binding domain |
Gene3D | G3DSA:2.40.330.10 | 2.0E-8 | 2 | 40 | IPR015300 | DNA-binding pseudobarrel domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 74 aa Download sequence Send to blast |
XVIYDGWNEF MTENDLEVGD VCIFELLNRA EIVLYVSIVR VSDFLKQERS QVINSTEGEK 60 KPEGDVRVKI ETDS |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | A0A2P5BZ32 | 4e-15 | A0A2P5BZ32_PARAD; B3 DNA binding domain containing protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF16088 | 5 | 9 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G18990.1 | 9e-09 | B3 family protein |