PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK19059.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 164aa MW: 18469.5 Da PI: 9.717 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 176.1 | 9.9e-55 | 21 | 149 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kge 98 lppGfrFhPtdeelvv+yLk+k+++ +l++ ++i+e+d+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+++s+ +e PK19059.1 21 LPPGFRFHPTDEELVVHYLKRKAASAPLPV-TIIAEIDLYKFDPWELPSKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPIMSSngCHE 119 79****************************.89***************988899****************************************977778 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 +vg+kk Lvfy g+ pkg+kt+W+mheyrl PK19059.1 120 KVGVKKALVFYGGKPPKGVKTNWIMHEYRL 149 8***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.62E-61 | 16 | 155 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 56.884 | 21 | 164 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.1E-29 | 22 | 149 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MENSTDSSSS LRSSQEQHPK LPPGFRFHPT DEELVVHYLK RKAASAPLPV TIIAEIDLYK 60 FDPWELPSKA SFGEQEWYFF SPRDRKYPNG ARPNRAATSG YWKATGTDKP IMSSNGCHEK 120 VGVKKALVFY GGKPPKGVKT NWIMHEYRLV DSSSSSSTNI NNIX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-69 | 21 | 162 | 17 | 156 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-69 | 21 | 162 | 17 | 156 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-69 | 21 | 162 | 17 | 156 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-69 | 21 | 162 | 17 | 156 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-69 | 21 | 162 | 20 | 159 | NAC domain-containing protein 19 |
3swm_B | 2e-69 | 21 | 162 | 20 | 159 | NAC domain-containing protein 19 |
3swm_C | 2e-69 | 21 | 162 | 20 | 159 | NAC domain-containing protein 19 |
3swm_D | 2e-69 | 21 | 162 | 20 | 159 | NAC domain-containing protein 19 |
3swp_A | 2e-69 | 21 | 162 | 20 | 159 | NAC domain-containing protein 19 |
3swp_B | 2e-69 | 21 | 162 | 20 | 159 | NAC domain-containing protein 19 |
3swp_C | 2e-69 | 21 | 162 | 20 | 159 | NAC domain-containing protein 19 |
3swp_D | 2e-69 | 21 | 162 | 20 | 159 | NAC domain-containing protein 19 |
4dul_A | 1e-69 | 21 | 162 | 17 | 156 | NAC domain-containing protein 19 |
4dul_B | 1e-69 | 21 | 162 | 17 | 156 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor of the NAC family associated with male fertility. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018807000.1 | 3e-95 | PREDICTED: NAC transcription factor 25 | ||||
Swissprot | A2YMR0 | 1e-90 | NAC10_ORYSI; NAC transcription factor ONAC010 | ||||
TrEMBL | A0A2I4DIM4 | 6e-94 | A0A2I4DIM4_JUGRE; NAC transcription factor 25 | ||||
STRING | VIT_00s0375g00040.t01 | 2e-93 | (Vitis vinifera) | ||||
STRING | EOY28334 | 2e-93 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1623 | 34 | 98 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G61110.1 | 4e-85 | NAC domain containing protein 25 |