PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK17736.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 178aa MW: 19963 Da PI: 11.1048 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 36.2 | 1.1e-11 | 125 | 163 | 18 | 54 |
HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS Homeobox 18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 lFe ++yp+ +e++ LA+++gL+ +qV++WF N R + PK17736.1 125 LFEHflHPYPTDSEKQMLAQQTGLSRTQVSNWFINSRVR 163 5775569******************************98 PP | |||||||
2 | BELL | 37.3 | 6.9e-13 | 2 | 39 | 35 | 72 |
BELL 35 ssFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 sFe+vaglg+a+p++s A +aiS hF +Lk+ i++q+ PK17736.1 2 RSFETVAGLGNAAPFVSSATRAISNHFGSLKNSIMDQL 39 69*********************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF07526 | 1.4E-7 | 1 | 35 | IPR006563 | POX domain |
PROSITE profile | PS50071 | 13.297 | 104 | 167 | IPR001356 | Homeobox domain |
CDD | cd00086 | 6.90E-14 | 107 | 168 | No hit | No description |
SMART | SM00389 | 1.8E-12 | 107 | 171 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 7.27E-19 | 109 | 172 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 3.6E-29 | 110 | 171 | IPR009057 | Homeodomain-like |
Pfam | PF05920 | 8.3E-19 | 124 | 163 | IPR008422 | Homeobox KN domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
VRSFETVAGL GNAAPFVSSA TRAISNHFGS LKNSIMDQLI NSSSANAKNN ASNSSRTSTA 60 GFDYSNNNNN NTNAVKDDRI SRLVWASKTG LARNPIHNLT NFPRSAWRSQ RGLPEHAVAV 120 LRKWLFEHFL HPYPTDSEKQ MLAQQTGLSR TQVSNWFINS RVRLWKPMVE EIQDLQTX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3k2a_A | 1e-17 | 113 | 171 | 5 | 63 | Homeobox protein Meis2 |
3k2a_B | 1e-17 | 113 | 171 | 5 | 63 | Homeobox protein Meis2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that is involved in the preservation of the spiral phyllotactic arrangement leading to a regular pattern of organ initiation. Required for maintenance of stem cell fate in the shoot apical meristem, and is essential for specifying floral primordia and establishing early internode patterning events during inflorescence development. Acts as transcription repressor of AG expression in floral and inflorescence meristems. Is also responsive of the nuclear import of SHOOT MERISTEMLESS (STM). In the fruit, plays a central role in patterning by negatively regulating SHP expression in order to prevent replum cells from adopting a valve margin cell fate. {ECO:0000269|PubMed:12874117, ECO:0000269|PubMed:12897247, ECO:0000269|PubMed:13678595, ECO:0000269|PubMed:15019989, ECO:0000269|PubMed:15120075, ECO:0000269|PubMed:15155890, ECO:0000269|PubMed:16741748}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010108383.1 | 1e-65 | BEL1-like homeodomain protein 9 | ||||
Swissprot | Q9LZM8 | 1e-46 | BLH9_ARATH; BEL1-like homeodomain protein 9 | ||||
TrEMBL | A0A2P5ALG2 | 2e-76 | A0A2P5ALG2_TREOI; Homeodomain transcription factor | ||||
STRING | XP_010108383.1 | 6e-65 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2810 | 33 | 73 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G02030.1 | 2e-45 | TALE family protein |