PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK17504.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 61aa MW: 7046.89 Da PI: 9.9525 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 62.9 | 6.6e-20 | 9 | 56 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv+ +++ G g+W++ +r g++R++k+c++rw +yl PK17504.1 9 KGPWTPEEDQKLVKFIQKNGHGSWRALPRLAGLNRCGKSCRLRWTNYL 56 79********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.445 | 4 | 60 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.1E-18 | 5 | 60 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 3.3E-24 | 7 | 59 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.0E-15 | 8 | 58 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.4E-18 | 9 | 56 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.61E-11 | 11 | 56 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 61 aa Download sequence Send to blast |
CCDESGLKKG PWTPEEDQKL VKFIQKNGHG SWRALPRLAG LNRCGKSCRL RWTNYLRPDI 60 X |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012064723.1 | 6e-39 | myb-related protein 330 | ||||
Swissprot | Q9S9Z2 | 9e-36 | MYB93_ARATH; Transcription factor MYB93 | ||||
TrEMBL | A0A067LQI0 | 1e-37 | A0A067LQI0_JATCU; MYB family protein | ||||
STRING | XP_010087606.1 | 7e-38 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G34670.1 | 4e-38 | myb domain protein 93 |
Publications ? help Back to Top | |||
---|---|---|---|
|