PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK17499.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family TALE
Protein Properties Length: 129aa    MW: 15416.5 Da    PI: 9.695
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK17499.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-0954901955
               HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox 19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55
                +k +yps++++  LA+++gL+ +q+ +WF N+R ++
  PK17499.1 54 HYKWPYPSEAQKLGLAESTGLDLKQINNWFINQRKRH 90
               55679*****************************985 PP

2ELK41.72.3e-141031122
        ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
               ELK qLlrKYsgyLg+LkqEF+
  PK17499.1 10 ELKVQLLRKYSGYLGGLKQEFL 31
               9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037895.8E-101031IPR005539ELK domain
SMARTSM011881.1E-61031IPR005539ELK domain
PROSITE profilePS5121310.9821030IPR005539ELK domain
PROSITE profilePS5007111.8073093IPR001356Homeobox domain
SMARTSM003893.0E-103297IPR001356Homeobox domain
SuperFamilySSF466894.71E-2032107IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-283595IPR009057Homeodomain-like
CDDcd000863.78E-114294No hitNo description
PfamPF059201.3E-175089IPR008422Homeobox KN domain
PROSITE patternPS0002706891IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
LIDPQAEDKE LKVQLLRKYS GYLGGLKQEF LKKKKNGKLP KEARQQLLEW WSRHYKWPYP  60
SEAQKLGLAE STGLDLKQIN NWFINQRKRH WKPSEDMQFV VMDAAHPAHY YMDNIIYNPF  120
SMDTIFDPX
Functional Description ? help Back to Top
Source Description
UniProtRequired for shoot apical meristem (SAM) formation during embryogenesis. Negatively regulates ASYMMETRIC LEAVES1 (AS1) and ASYMMETRIC LEAVES2 (AS2 or LBD6). Probably binds to the DNA sequence 5'-TGAC-3'. Binds to RNA (By similarity). {ECO:0000250|UniProtKB:P24345, ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:11934861}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001302988.18e-73homeobox protein SHOOT MERISTEMLESS
RefseqXP_010089440.17e-73homeobox protein knotted-1-like LET6
RefseqXP_021889118.14e-73homeobox protein SBH1
SwissprotQ388742e-67STM_ARATH; Homeobox protein SHOOT MERISTEMLESS
TrEMBLA0A2P5AYI83e-74A0A2P5AYI8_PARAD; Knotted-like homeobox transcription factor
STRINGevm.model.supercontig_152.565e-73(Carica papaya)
STRINGXP_010089440.13e-72(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.12e-62KNOX/ELK homeobox transcription factor
Publications ? help Back to Top
  1. Zhang XL,Yang ZP,Zhang J,Zhang LG
    Ectopic expression of BraYAB1-702, a member of YABBY gene family in Chinese cabbage, causes leaf curling, inhibition of development of shoot apical meristem and flowering stage delaying in Arabidopsis thaliana.
    Int J Mol Sci, 2013. 14(7): p. 14872-91
    [PMID:23863694]
  2. Liu C, et al.
    Phosphatidylserine synthase 1 is required for inflorescence meristem and organ development in Arabidopsis.
    J Integr Plant Biol, 2013. 55(8): p. 682-95
    [PMID:23931744]
  3. Simonini S,Kater MM
    Class I BASIC PENTACYSTEINE factors regulate HOMEOBOX genes involved in meristem size maintenance.
    J. Exp. Bot., 2014. 65(6): p. 1455-65
    [PMID:24482368]
  4. Scofield S,Dewitte W,Murray JA
    STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1.
    Plant Signal Behav, 2018.
    [PMID:24776954]
  5. Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M
    The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development.
    Front Plant Sci, 2014. 5: p. 165
    [PMID:24817871]
  6. Chen C, et al.
    Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.).
    J. Exp. Bot., 2014. 65(17): p. 4943-58
    [PMID:24962999]
  7. Lee JE,Lampugnani ER,Bacic A,Golz JF
    SEUSS and SEUSS-LIKE 2 coordinate auxin distribution and KNOXI activity during embryogenesis.
    Plant J., 2014. 80(1): p. 122-35
    [PMID:25060324]
  8. Ckurshumova W,Berleth T
    Overcoming recalcitrance - Auxin response factor functions in plant regeneration.
    Plant Signal Behav, 2015. 10(7): p. e993293
    [PMID:26098229]
  9. Liang Z,Brown RC,Fletcher JC,Opsahl-Sorteberg HG
    Calpain-Mediated Positional Information Directs Cell Wall Orientation to Sustain Plant Stem Cell Activity, Growth and Development.
    Plant Cell Physiol., 2015. 56(9): p. 1855-66
    [PMID:26220906]
  10. Rast-Somssich MI, et al.
    Alternate wiring of a KNOXI genetic network underlies differences in leaf development of A. thaliana and C. hirsuta.
    Genes Dev., 2015. 29(22): p. 2391-404
    [PMID:26588991]
  11. Landrein B, et al.
    Mechanical stress contributes to the expression of the STM homeobox gene in Arabidopsis shoot meristems.
    Elife, 2015. 4: p. e07811
    [PMID:26623515]
  12. Guzmán-López JA,Abraham-Juárez MJ,Lozano-Sotomayor P,de Folter S,Simpson J
    Arabidopsis thaliana gonidialess A/Zuotin related factors (GlsA/ZRF) are essential for maintenance of meristem integrity.
    Plant Mol. Biol., 2016. 91(1-2): p. 37-51
    [PMID:26826012]
  13. Shi B, et al.
    Two-Step Regulation of a Meristematic Cell Population Acting in Shoot Branching in Arabidopsis.
    PLoS Genet., 2016. 12(7): p. e1006168
    [PMID:27398935]
  14. Lee HG,Choi YR,Seo PJ
    Increased STM expression is associated with drought tolerance in Arabidopsis.
    J. Plant Physiol., 2016. 201: p. 79-84
    [PMID:27448723]
  15. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  16. Singh S, et al.
    Sirtinol, a Sir2 protein inhibitor, affects stem cell maintenance and root development in Arabidopsis thaliana by modulating auxin-cytokinin signaling components.
    Sci Rep, 2017. 7: p. 42450
    [PMID:28195159]
  17. Lee HG,Choi YR,Seo PJ
    Erratum to "Increased STM expression is associated with drought tolerance in Arabidopsis" [J. Plant Physiol. 201 (2016) 79-84].
    J. Plant Physiol., 2018. 228: p. 218
    [PMID:28456397]
  18. Xue T, et al.
    ARGONAUTE10 Inhibits In Vitro Shoot Regeneration Via Repression of miR165/166 in Arabidopsis thaliana.
    Plant Cell Physiol., 2017. 58(10): p. 1789-1800
    [PMID:29016889]
  19. Dolzblasz A, et al.
    Impairment of Meristem Proliferation in Plants Lacking the Mitochondrial Protease AtFTSH4.
    Int J Mol Sci, 2018.
    [PMID:29538317]
  20. Scofield S, et al.
    Coordination of meristem and boundary functions by transcription factors in the SHOOT MERISTEMLESS regulatory network.
    Development, 2018.
    [PMID:29650590]
  21. Liu L, et al.
    FTIP-Dependent STM Trafficking Regulates Shoot Meristem Development in Arabidopsis.
    Cell Rep, 2018. 23(6): p. 1879-1890
    [PMID:29742441]
  22. Chung Y, et al.
    Auxin Response Factors promote organogenesis by chromatin-mediated repression of the pluripotency gene SHOOTMERISTEMLESS.
    Nat Commun, 2019. 10(1): p. 886
    [PMID:30792395]