PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PK17293.1

Organism

Cannabis sativa

Taxonomic ID

3483

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

MYB

Protein Properties

Length: 131aa MW: 14518.2 Da PI: 9.8777

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK17293.1	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	58.2	1.9e-18	40	87	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+ Ed l ++vk++G g+W+++ ++ g++R++k+c++rw ++l PK17293.1 40 KGPWTAAEDHVLMEYVKKHGEGNWNSVQKYSGLNRCGKSCRLRWANHL 87 79******************************************9996 PP
2	Myb_DNA-binding	43.3	8.7e-14	93	131	1	41
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqck 41 +g++T+eE+ l++++++++G++ W++ a+ ++ gRt++++k PK17293.1 93 KGSFTPEEERLILELHAKYGNK-WARMAAQLP-GRTDNEIK 131 799*****************.*****.****98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	24.149	35	91	IPR017930	Myb domain
SuperFamily	SSF46689	1.61E-30	39	131	IPR009057	Homeodomain-like
SMART	SM00717	2.2E-13	39	89	IPR001005	SANT/Myb domain
Pfam	PF00249	7.8E-17	40	87	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.4E-25	41	94	IPR009057	Homeodomain-like
CDD	cd00167	1.01E-9	42	87	No hit	No description
SMART	SM00717	6.9E-6	92	131	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	18.095	92	131	IPR017930	Myb domain
Pfam	PF00249	5.2E-13	93	131	IPR001005	SANT/Myb domain
CDD	cd00167	3.15E-9	95	131	No hit	No description
Gene3D	G3DSA:1.10.10.60	3.8E-21	95	131	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 131 aa Download sequence Send to blast
XYFFLVMTPY NNGSAQSEGG SSGSSGGKCV SGPDGAILKK GPWTAAEDHV LMEYVKKHGE 60 GNWNSVQKYS GLNRCGKSCR LRWANHLRPN LKKGSFTPEE ERLILELHAK YGNKWARMAA 120 QLPGRTDNEI K

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	4e-28	33	131	3	97	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator of alpha-amylase expression that binds to 5'-CAACTGTC-3' motif in target gene promoter (PubMed:11743113). Positive regulator of abscisic acid (ABA) responses leading to growth arrest during seed germination (PubMed:17217461). In vegetative tissues, inhibits growth by reducing cell proliferation. Promotes the expression of aleurone-related genes (e.g. CP1, CP, GASA1, BXL1 and BXL2) in seeds. Together with MYB65 and MYB101, promotes the programmed cell death (PCD) the vacuolation of protein storage vacuoles (PSVs) in the aleurone layers during seed germination (PubMed:20699403). Binds to a GARE site (GA-response element) in the LEAFY promoter, essential for its gibberellic acid (GA)-mediated induction (PubMed:15226253). Together with MYB65, facilitates anther and tapetum development (PubMed:15722475). {ECO:0000269\|PubMed:11743113, ECO:0000269\|PubMed:15226253, ECO:0000269\|PubMed:15722475, ECO:0000269\|PubMed:17217461, ECO:0000269\|PubMed:20699403}.
UniProt	Transcriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. May bind to the 5'-TAACAAA-3' box of alpha-amylase promoter. {ECO:0000269\|PubMed:9150608}.
UniProt	Transcriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. May bind to the 5'-TAACAAA-3' box of alpha-amylase promoter. Required for anther development (PubMed:19454733, PubMed:20590996). Functions in parallel with UDT1 to regulate early anther development. Functions upstream of the transcription factor TDR and may positively regulate its transcription (PubMed:20590996). Required for pollen development. Probably required for controlling tapetal cell size and promoting tapetal programmed cell death (PCD) during anther development. Required for exine and Ubisch body formation in anthers. Interacts with the DNA specific motifs of giberrellin-up-regulated genes of anthers and regulates their expression. Positively regulates the expression of the laurate hydroxylase CYP703A3, known to be essential for the development of pollen exine and anther epicuticular layer (PubMed:19454733). Functions with MYBS1 to integrate diverse nutrient starvation and gibberellin (GA) signaling pathways during germination of grains. Sugar, nitrogen and phosphate starvation signals converge and interconnect with GA to promote the co-nuclear import of GAMYB and MYBS1, resulting in the expression of a large set of GA-inducible hydrolases, transporters and regulators that are essential for mobilization of nutrient reserves in the endosperm to support seedling growth (PubMed:22773748). {ECO:0000269\|PubMed:14688295, ECO:0000269\|PubMed:19454733, ECO:0000269\|PubMed:20590996, ECO:0000269\|PubMed:22773748}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Accumulates at the shoot apex upon the transition from short- to long-day photoperiods leading to flowering and after gibberellins (GAs) treatment (PubMed:11743113). Repressed by microRNA159 (miR159a and miR159b) in vegetative tissues (PubMed:15226253, PubMed:20699403, PubMed:17916625). Specific expression in floral organs and in the shoot apices is regulated via miR159-mediated degradation (PubMed:15722475). Repressed in germinating seeds by miR159-mediated cleavage in an abscisic acid (ABA) and ABI3-dependent manner, probably to desensitize hormone signaling during seedling stress responses (PubMed:17217461, PubMed:18305205). Slightly induced by ethylene and cytokinins (PubMed:9839469). {ECO:0000269\|PubMed:11743113, ECO:0000269\|PubMed:15226253, ECO:0000269\|PubMed:15722475, ECO:0000269\|PubMed:17217461, ECO:0000269\|PubMed:17916625, ECO:0000269\|PubMed:18305205, ECO:0000269\|PubMed:20699403, ECO:0000269\|PubMed:9839469}.
UniProt	INDUCTION: By gibberellin in aleurone cells. {ECO:0000269\|PubMed:14688295}.
UniProt	INDUCTION: By gibberellin in aleurone cells. {ECO:0000269\|PubMed:9150608}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015899738.1	1e-61	transcription factor MYB120-like isoform X2
Swissprot	A2WW87	2e-53	GAM1_ORYSI; Transcription factor GAMYB
Swissprot	Q0JIC2	2e-53	GAMYB_ORYSJ; Transcription factor GAMYB
Swissprot	Q8W1W6	1e-53	MYB33_ARATH; Transcription factor MYB33
TrEMBL	A0A2P5BRQ5	1e-61	A0A2P5BRQ5_PARAD; MYB transcription factor
TrEMBL	A0A2P5F2F1	1e-61	A0A2P5F2F1_TREOI; MYB transcription factor
STRING	XP_009338730.1	6e-60	(Pyrus x bretschneideri)
STRING	XP_004295832.1	8e-59	(Fragaria vesca)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G32460.1	2e-55	myb domain protein 101

Publications ? help Back to Top
Gocal GF, et al. Long-day up-regulation of a GAMYB gene during Lolium temulentum inflorescence formation. Plant Physiol., 1999. 119(4): p. 1271-8 [PMID:10198085] Ueguchi-Tanaka M, et al. Rice dwarf mutant d1, which is defective in the alpha subunit of the heterotrimeric G protein, affects gibberellin signal transduction. Proc. Natl. Acad. Sci. U.S.A., 2000. 97(21): p. 11638-43 [PMID:11027362] Sutoh K,Yamauchi D Two cis-acting elements necessary and sufficient for gibberellin-upregulated proteinase expression in rice seeds. Plant J., 2003. 34(5): p. 635-45 [PMID:12787245] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Washio K Functional dissections between GAMYB and Dof transcription factors suggest a role for protein-protein associations in the gibberellin-mediated expression of the RAmy1A gene in the rice aleurone. Plant Physiol., 2003. 133(2): p. 850-63 [PMID:14500792] Eastmond PJ,Jones RL Hormonal regulation of gluconeogenesis in cereal aleurone is strongly cultivar-dependent and gibberellin action involves SLENDER1 but not GAMYB. Plant J., 2005. 44(3): p. 483-93 [PMID:16236157] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Xie Z, et al. Interactions of two abscisic-acid induced WRKY genes in repressing gibberellin signaling in aleurone cells. Plant J., 2006. 46(2): p. 231-42 [PMID:16623886] Tsuji H, et al. GAMYB controls different sets of genes and is differentially regulated by microRNA in aleurone cells and anthers. Plant J., 2006. 47(3): p. 427-44 [PMID:16792694] Wang Y,Wang YF,Zhang DB [Identification of the rice (Oryza sativa L.) mutant msp1-4 and expression analysis of its UDT1 and GAMYB genes]. Zhi Wu Sheng Li Yu Fen Zi Sheng Wu Xue Xue Bao, 2006. 32(5): p. 527-34 [PMID:17075175] Allen RS, et al. Genetic analysis reveals functional redundancy and the major target genes of the Arabidopsis miR159 family. Proc. Natl. Acad. Sci. U.S.A., 2007. 104(41): p. 16371-6 [PMID:17916625] Liu SM,Wang ZY,Cai XL [Preliminary screening of target genes of rice transcription factor OsBP-73]. Zhi Wu Sheng Li Yu Fen Zi Sheng Wu Xue Xue Bao, 2007. 33(5): p. 456-62 [PMID:17960050] Aya K, et al. Gibberellin modulates anther development in rice via the transcriptional regulation of GAMYB. Plant Cell, 2009. 21(5): p. 1453-72 [PMID:19454733] Hu L,Tan H,Liang W,Zhang D The Post-meiotic Deficicent Anther1 (PDA1) gene is required for post-meiotic anther development in rice. J Genet Genomics, 2010. 37(1): p. 37-46 [PMID:20171576] Liu Z,Bao W,Liang W,Yin J,Zhang D Identification of gamyb-4 and analysis of the regulatory role of GAMYB in rice anther development. J Integr Plant Biol, 2010. 52(7): p. 670-8 [PMID:20590996] Plackett AR,Thomas SG,Wilson ZA,Hedden P Gibberellin control of stamen development: a fertile field. Trends Plant Sci., 2011. 16(10): p. 568-78 [PMID:21824801] Aya K, et al. The Gibberellin perception system evolved to regulate a pre-existing GAMYB-mediated system during land plant evolution. Nat Commun, 2011. 2: p. 544 [PMID:22109518] Hong YF, et al. Convergent starvation signals and hormone crosstalk in regulating nutrient mobilization upon germination in cereals. Plant Cell, 2012. 24(7): p. 2857-73 [PMID:22773748] Wang Y, et al. TamiR159 directed wheat TaGAMYB cleavage and its involvement in anther development and heat response. PLoS ONE, 2012. 7(11): p. e48445 [PMID:23133634] Zhang Y, et al. GmGBP1, a homolog of human ski interacting protein in soybean, regulates flowering and stress tolerance in Arabidopsis. BMC Plant Biol., 2013. 13: p. 21 [PMID:23388059] Heidari B,Nemie-Feyissa D,Kangasjärvi S,Lillo C Antagonistic regulation of flowering time through distinct regulatory subunits of protein phosphatase 2A. PLoS ONE, 2013. 8(7): p. e67987 [PMID:23976921] Li J,Reichel M,Millar AA Determinants beyond both complementarity and cleavage govern microR159 efficacy in Arabidopsis. PLoS Genet., 2014. 10(3): p. e1004232 [PMID:24626050] Zhang Y, et al. A GAMYB homologue CsGAMYB1 regulates sex expression of cucumber via an ethylene-independent pathway. J. Exp. Bot., 2014. 65(12): p. 3201-13 [PMID:24790111] Yano K, et al. Comprehensive gene expression analysis of rice aleurone cells: probing the existence of an alternative gibberellin receptor. Plant Physiol., 2015. 167(2): p. 531-44 [PMID:25511432] Sutoh K, et al. An N-terminal region of a Myb-like protein is involved in its intracellular localization and activation of a gibberellin-inducible proteinase gene in germinated rice seeds. Biosci. Biotechnol. Biochem., 2015. 79(5): p. 747-59 [PMID:25559339] Kwon CT,Kim SH,Kim D,Paek NC The Rice Floral Repressor Early flowering1 Affects Spikelet Fertility By Modulating Gibberellin Signaling. Rice (N Y), 2015. 8(1): p. 58 [PMID:26202549] Li Y,Alonso-Peral M,Wong G,Wang MB,Millar AA Ubiquitous miR159 repression of MYB33/65 in Arabidopsis rosettes is robust and is not perturbed by a wide range of stresses. BMC Plant Biol., 2016. 16(1): p. 179 [PMID:27542984] Liu B,De Storme N,Geelen D Gibberellin Induces Diploid Pollen Formation by Interfering with Meiotic Cytokinesis. Plant Physiol., 2017. 173(1): p. 338-353 [PMID:27621423] Zhang F, et al. Phosphorylation of CBP20 Links MicroRNA to Root Growth in the Ethylene Response. PLoS Genet., 2016. 12(11): p. e1006437 [PMID:27870849] Zheng Z, et al. Target RNA Secondary Structure Is a Major Determinant of miR159 Efficacy. Plant Physiol., 2017. 174(3): p. 1764-1778 [PMID:28515145] Guo C, et al. Repression of miR156 by miR159 Regulates the Timing of the Juvenile-to-Adult Transition in Arabidopsis. Plant Cell, 2017. 29(6): p. 1293-1304 [PMID:28536099] Xue T,Liu Z,Dai X,Xiang F Primary root growth in Arabidopsis thaliana is inhibited by the miR159 mediated repression of MYB33, MYB65 and MYB101. Plant Sci., 2017. 262: p. 182-189 [PMID:28716415] Medina C, et al. Characterization of microRNAs from Arabidopsis galls highlights a role for miR159 in the plant response to the root-knot nematode Meloidogyne incognita. New Phytol., 2017. 216(3): p. 882-896 [PMID:28906559] Kim MH, et al. Poplar MYB transcription factor PtrMYB012 and its Arabidopsis AtGAMYB orthologs are differentially repressed by the Arabidopsis miR159 family. Tree Physiol., 2018. 38(6): p. 801-812 [PMID:29301041] Suzuki A, et al. Cloning and expression of five myb-related genes from rice seed. Gene, 1997. 198(1-2): p. 393-8 [PMID:9370307]