PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK16329.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 104aa MW: 12004.5 Da PI: 10.4813 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.6 | 2.8e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd+ l+d +k+ G g+W+t ++ g++R++k+c++rw +yl PK16329.1 14 KGPWTPEEDQALIDHIKRNGHGRWRTLPKNAGLKRCGKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 39.9 | 9.8e-13 | 67 | 103 | 1 | 39 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39 rgr++ eE+e +++++ lG++ W++Ia++++ gRt+++ PK16329.1 67 RGRFSFEEEETIIQLHSVLGNK-WSAIAARLP-GRTDNE 103 89********************.*********.****96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.2E-26 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.704 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.15E-28 | 11 | 103 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.8E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.4E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.51E-11 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.7E-19 | 65 | 103 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 0.026 | 66 | 104 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 13.852 | 66 | 104 | IPR017930 | Myb domain |
Pfam | PF00249 | 4.1E-11 | 67 | 103 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.45E-6 | 69 | 103 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MGKITCCEKN GLKKGPWTPE EDQALIDHIK RNGHGRWRTL PKNAGLKRCG KSCRLRWTNY 60 LRPDIKRGRF SFEEEETIIQ LHSVLGNKWS AIAARLPGRT DNEX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-25 | 12 | 102 | 25 | 114 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011096186.1 | 9e-67 | protein ODORANT1 | ||||
Swissprot | Q9LDR8 | 1e-64 | MY102_ARATH; Transcription factor MYB102 | ||||
TrEMBL | A0A2P5F3L5 | 4e-69 | A0A2P5F3L5_TREOI; MYB transcription factor | ||||
STRING | ERN03536 | 8e-66 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G21440.1 | 4e-67 | MYB-like 102 |
Publications ? help Back to Top | |||
---|---|---|---|
|