PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK13647.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 135aa MW: 15512.7 Da PI: 8.2088 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 57 | 2.6e-18 | 70 | 104 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C++C + kTp+WR gp g+ktLCnaCG++y++ +l PK13647.1 70 CTHCLSQKTPQWRAGPLGPKTLCNACGVRYKSGRL 104 *******************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 2.2E-15 | 64 | 118 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 11.147 | 67 | 100 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 3.14E-15 | 68 | 128 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 3.0E-14 | 68 | 102 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 5.97E-13 | 69 | 116 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 70 | 95 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 4.4E-16 | 70 | 104 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 135 aa Download sequence Send to blast |
MPKNTTTNFE YPPLLKQTYW LCDSELIVPK KDVDKNEEER EKENGDLVKE IDEDEEQLGF 60 MAHGLVARRC THCLSQKTPQ WRAGPLGPKT LCNACGVRYK SGRLLPEYRP AKSPTFVSYL 120 HSNSHKKVME MRNGS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019432694.1 | 8e-55 | PREDICTED: GATA transcription factor 5-like isoform X1 | ||||
Refseq | XP_019432695.1 | 8e-55 | PREDICTED: GATA transcription factor 5-like isoform X2 | ||||
Swissprot | O82632 | 2e-35 | GATA9_ARATH; GATA transcription factor 9 | ||||
TrEMBL | A0A2P5DHI0 | 4e-56 | A0A2P5DHI0_TREOI; GATA transcription factor | ||||
STRING | XP_007161927.1 | 7e-54 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF8487 | 24 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G60530.1 | 2e-38 | GATA transcription factor 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|