PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK13281.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 140aa MW: 16767.2 Da PI: 10.7668 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.2 | 9.2e-19 | 18 | 65 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd ll++++ ++G g+W++ a++ g++Rt+k+c++rw++yl PK13281.1 18 RGPWTLEEDTLLIHYISLHGEGHWNLLAKRAGLKRTGKSCRLRWLNYL 65 89*********************************************7 PP | |||||||
2 | Myb_DNA-binding | 53.6 | 5e-17 | 71 | 114 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++ PK13281.1 71 RGNLTPQEQLLILELHSKWGNR-WSRIAQHLP-GRTDNEIKNYWRT 114 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.348 | 13 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.95E-31 | 16 | 112 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.0E-16 | 17 | 67 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-17 | 18 | 65 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.4E-24 | 19 | 72 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.47E-10 | 20 | 65 | No hit | No description |
PROSITE profile | PS51294 | 25.445 | 66 | 120 | IPR017930 | Myb domain |
SMART | SM00717 | 5.7E-15 | 70 | 118 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.3E-16 | 71 | 114 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.7E-24 | 73 | 119 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.19E-10 | 75 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
MHTITTKFNN EEEIELRRGP WTLEEDTLLI HYISLHGEGH WNLLAKRAGL KRTGKSCRLR 60 WLNYLKPDIK RGNLTPQEQL LILELHSKWG NRWSRIAQHL PGRTDNEIKN YWRTRVQKQA 120 RQLNIESNSK KFIEAVRGFW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-26 | 15 | 120 | 4 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor of phosphate (Pi) starvation-induced genes. Regulates negatively Pi starvation responses via the repression of gibberellic acid (GA) biosynthesis and signaling. Modulates root architecture, phosphatase activity, and Pi uptake and accumulation. {ECO:0000269|PubMed:19529828}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00159 | DAP | Transfer from AT1G25340 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by salicylic acid (PubMed:16463103). Induced reversibly in response to phosphate (Pi) deficiency but repressed in the presence of Pi, specifically in the leaves. Availability of Pi increases with decreased levels (PubMed:19529828). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19529828}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010099251.1 | 2e-87 | transcription factor MYB62 | ||||
Swissprot | Q9C9G7 | 1e-76 | MYB62_ARATH; Transcription factor MYB62 | ||||
TrEMBL | A0A2P5F0S4 | 2e-88 | A0A2P5F0S4_TREOI; MYB transcription factor | ||||
TrEMBL | J9JF55 | 2e-88 | J9JF55_HUMLU; Myb transcription factor | ||||
STRING | XP_010099251.1 | 7e-87 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1639 | 34 | 94 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G25340.1 | 3e-80 | myb domain protein 116 |
Publications ? help Back to Top | |||
---|---|---|---|
|