PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK12151.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 57aa MW: 6860.56 Da PI: 10.4195 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 28.2 | 3.2e-09 | 26 | 56 | 20 | 50 |
HHSSS--HHHHHHHHHHCTS-HHHHHHHHHH CS Homeobox 20 eknrypsaeereeLAkklgLterqVkvWFqN 50 +k +yp+++++ LA+ +gL+++q+ +WF N PK12151.3 26 YKWPYPTEADKNALAETTGLDQKQINNWFIN 56 4679*************************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 11.677 | 1 | 57 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 2.14E-16 | 2 | 57 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 0.0025 | 3 | 57 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 5.6E-24 | 6 | 57 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 1.97E-8 | 10 | 57 | No hit | No description |
Pfam | PF05920 | 1.0E-15 | 21 | 57 | IPR008422 | Homeobox KN domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 57 aa Download sequence Send to blast |
XSKKKKKGKL PREARQTLLD WWNLHYKWPY PTEADKNALA ETTGLDQKQI NNWFINQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024023903.1 | 3e-33 | homeobox protein knotted-1-like 6 | ||||
Swissprot | Q84JS6 | 5e-27 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A2P5FMJ6 | 3e-32 | A0A2P5FMJ6_TREOI; Knotted-like homeobox transcription factor | ||||
STRING | XP_010100424.1 | 1e-32 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF620 | 34 | 125 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 3e-29 | KNOTTED1-like homeobox gene 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|