PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK12151.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family HB-other
Protein Properties Length: 57aa    MW: 6860.56 Da    PI: 10.4195
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK12151.3genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.2e-0926562050
               HHSSS--HHHHHHHHHHCTS-HHHHHHHHHH CS
   Homeobox 20 eknrypsaeereeLAkklgLterqVkvWFqN 50
               +k +yp+++++  LA+ +gL+++q+ +WF N
  PK12151.3 26 YKWPYPTEADKNALAETTGLDQKQINNWFIN 56
               4679*************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.677157IPR001356Homeobox domain
SuperFamilySSF466892.14E-16257IPR009057Homeodomain-like
SMARTSM003890.0025357IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.6E-24657IPR009057Homeodomain-like
CDDcd000861.97E-81057No hitNo description
PfamPF059201.0E-152157IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 57 aa     Download sequence    Send to blast
XSKKKKKGKL PREARQTLLD WWNLHYKWPY PTEADKNALA ETTGLDQKQI NNWFINQ
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024023903.13e-33homeobox protein knotted-1-like 6
SwissprotQ84JS65e-27KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLA0A2P5FMJ63e-32A0A2P5FMJ6_TREOI; Knotted-like homeobox transcription factor
STRINGXP_010100424.11e-32(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62034125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.13e-29KNOTTED1-like homeobox gene 6
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Khan M, et al.
    Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis.
    Plant Physiol., 2015. 169(3): p. 2166-86
    [PMID:26417006]