PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK11664.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 105aa MW: 12040.5 Da PI: 9.7136 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 64 | 3e-20 | 11 | 57 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd+++ ++v ++G W++Ia+ ++ gR +kqc++rw+++l PK11664.2 11 KGPWTPEEDKKITELVSKYGATKWSLIAKSLP-GRIGKQCRERWHNHL 57 79******************************.*************97 PP | |||||||
2 | Myb_DNA-binding | 49 | 1.4e-15 | 63 | 104 | 1 | 44 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 +++WT E++ l +a++ +G++ W+ Ia+ ++ gRt++ +k++w PK11664.2 63 KDAWTIAEELSLMHAHQIHGNK-WAEIAKVLP-GRTDNAIKNHW 104 689*******************.*********.*********** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 31.716 | 6 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.95E-33 | 8 | 104 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.5E-18 | 10 | 59 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-19 | 11 | 57 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.9E-28 | 12 | 65 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.69E-15 | 13 | 57 | No hit | No description |
SMART | SM00717 | 3.3E-5 | 62 | 105 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 18.467 | 62 | 105 | IPR017930 | Myb domain |
Pfam | PF00249 | 4.3E-14 | 63 | 104 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.44E-9 | 65 | 104 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 6.6E-19 | 66 | 104 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 105 aa Download sequence Send to blast |
MAEGPNPDLV KGPWTPEEDK KITELVSKYG ATKWSLIAKS LPGRIGKQCR ERWHNHLNPE 60 IRKDAWTIAE ELSLMHAHQI HGNKWAEIAK VLPGRTDNAI KNHWX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-49 | 7 | 104 | 3 | 100 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (By similarity). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). {ECO:0000250|UniProtKB:Q94FL9, ECO:0000269|PubMed:26069325}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by ethylene, auxin (IAA), jasmonic acid (JA) and salicylic acid (SA). {ECO:0000269|PubMed:16463103}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006429084.1 | 2e-58 | transcription factor MYB3R-5 | ||||
Refseq | XP_006429085.1 | 2e-58 | transcription factor MYB3R-5 | ||||
Refseq | XP_006480818.1 | 2e-58 | transcription factor MYB3R-5 | ||||
Refseq | XP_006480819.1 | 2e-58 | transcription factor MYB3R-5 | ||||
Refseq | XP_006480820.1 | 2e-58 | transcription factor MYB3R-5 | ||||
Refseq | XP_024037722.1 | 2e-58 | transcription factor MYB3R-5 | ||||
Swissprot | Q8H1P9 | 5e-55 | MB3R3_ARATH; Transcription factor MYB3R-3 | ||||
TrEMBL | A0A2P5DS50 | 1e-59 | A0A2P5DS50_TREOI; GAMYB transcription factor | ||||
STRING | XP_006480818.1 | 8e-58 | (Citrus sinensis) | ||||
STRING | XP_006429084.1 | 8e-58 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6616 | 34 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G09370.1 | 2e-57 | myb domain protein 3r-3 |
Publications ? help Back to Top | |||
---|---|---|---|
|