PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK10767.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 179aa MW: 20048.5 Da PI: 5.0806 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 41.4 | 3.4e-13 | 80 | 120 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 W ++++ ll+++++++G g+W+ Ia+++g +++ +qc++++ PK10767.3 80 WNADDEILLLEGIEMYGLGNWTEIAEHVG-TKSKEQCINHYT 120 *****************************.**********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00291 | 8.1E-8 | 16 | 60 | IPR000433 | Zinc finger, ZZ-type |
Pfam | PF00569 | 2.2E-8 | 20 | 60 | IPR000433 | Zinc finger, ZZ-type |
SuperFamily | SSF57850 | 2.47E-14 | 20 | 83 | No hit | No description |
PROSITE profile | PS50135 | 10.52 | 20 | 63 | IPR000433 | Zinc finger, ZZ-type |
CDD | cd02335 | 9.02E-24 | 20 | 68 | No hit | No description |
PROSITE pattern | PS01357 | 0 | 22 | 49 | IPR000433 | Zinc finger, ZZ-type |
SuperFamily | SSF46689 | 5.31E-14 | 72 | 126 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51293 | 21.974 | 75 | 127 | IPR017884 | SANT domain |
SMART | SM00717 | 1.9E-11 | 76 | 125 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.9E-13 | 79 | 120 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.70E-13 | 80 | 119 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 6.2E-9 | 80 | 121 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
GENLESTTAG QGTSEGKALY HCNYCNKDIT GKIRIKCCTC ADFDLCIECF SVGAEVQPHK 60 SNHPYRVMDN LSFPLICPDW NADDEILLLE GIEMYGLGNW TEIAEHVGTK SKEQCINHYT 120 DVYMNSPLFP LPDMSHVVGK NRKELLAMAK GHSEEKKGLP MISELDXKEE SPFSPSRIK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6cw3_E | 7e-39 | 16 | 135 | 1 | 120 | Transcriptional adapter 2 |
6cw3_G | 7e-39 | 16 | 135 | 1 | 120 | Transcriptional adapter 2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Required for the function of some acidic activation domains, which activate transcription from a distant site. The exact mechanism of action is not yet known. ADA2 and GCN5 function to acetylate nucleosomes, opening up the promoter region (By similarity). {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018823893.1 | 1e-116 | PREDICTED: transcriptional adapter ADA2-like | ||||
Swissprot | Q75LL6 | 1e-92 | TADA2_ORYSJ; Transcriptional adapter ADA2 | ||||
TrEMBL | A0A2P5EXL1 | 1e-122 | A0A2P5EXL1_TREOI; Transcriptional adapter | ||||
STRING | VIT_00s0194g00130.t01 | 1e-111 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1537 | 17 | 26 |
Publications ? help Back to Top | |||
---|---|---|---|
|