PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK09548.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 81aa MW: 9563.71 Da PI: 6.3389 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 38.3 | 2.4e-12 | 2 | 62 | 36 | 99 |
EEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS B3 36 ltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 + l+ + g Wev+l + ++g+++++kGW +F+ L g f+vF+++g+s f +v +f++ PK09548.1 2 VFLRVPCGSIWEVEL-TKSNDGKVWMEKGWDKFALHFSLSRGNFLVFRYEGDSHF--HVIIFDT 62 567778899******.3555666****************************9999..9999987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd10017 | 6.10E-12 | 1 | 61 | No hit | No description |
PROSITE profile | PS50863 | 13.239 | 1 | 63 | IPR003340 | B3 DNA binding domain |
Gene3D | G3DSA:2.40.330.10 | 9.2E-16 | 2 | 73 | IPR015300 | DNA-binding pseudobarrel domain |
SuperFamily | SSF101936 | 5.3E-16 | 2 | 62 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 3.4E-9 | 2 | 62 | IPR003340 | B3 DNA binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 81 aa Download sequence Send to blast |
QVFLRVPCGS IWEVELTKSN DGKVWMEKGW DKFALHFSLS RGNFLVFRYE GDSHFHVIIF 60 DTTNTEIDYP HSSNHFEKQN V |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012472260.1 | 9e-25 | PREDICTED: B3 domain-containing transcription factor VRN1-like | ||||
TrEMBL | A0A2P5FY03 | 9e-27 | A0A2P5FY03_TREOI; B3 DNA binding domain containing protein (Fragment) | ||||
STRING | XP_010113419.1 | 2e-26 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF98 | 34 | 369 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G49475.1 | 6e-17 | B3 family protein |