PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PK06515.5

Organism

Cannabis sativa

Taxonomic ID

3483

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

MYB_related

Protein Properties

Length: 90aa MW: 10438.5 Da PI: 10.2815

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK06515.5	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	42.4	1.6e-13	34	78	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r +W +eE++++++a +++ + Wk+I +g +t q++s+ qky PK06515.5 34 RESWAEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 78 789***************77.*****.***********9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	6.95E-17	28	84	IPR009057	Homeodomain-like
PROSITE profile	PS51294	15.439	29	83	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	8.9E-8	31	87	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	2.1E-18	32	81	IPR006447	Myb domain, plants
SMART	SM00717	4.3E-10	33	81	IPR001005	SANT/Myb domain
Pfam	PF00249	3.4E-11	34	78	IPR001005	SANT/Myb domain
CDD	cd00167	1.98E-7	36	79	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
XKMNSNPSNN PQSTTPADAS AKKIRKPYTI TKSRESWAEE EHDKFLEALQ LFDRDWKKIE 60 DFVGSKTVIQ IRSHAQKYFQ KVQKNGTLAH

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator of evening element (EE)-containing clock-controlled genes. Forms a negative feedback loop with APRR5. Regulates the pattern of histone H3 acetylation of the TOC1 promoter. {ECO:0000269\|PubMed:21205033, ECO:0000269\|PubMed:21474993, ECO:0000269\|PubMed:21483796, ECO:0000269\|PubMed:23638299}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. Peak of expression in the afternoon. Down-regulated by cold. {ECO:0000269\|PubMed:21205033, ECO:0000269\|PubMed:22902701, ECO:0000269\|PubMed:23638299}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024024228.1	2e-51	protein REVEILLE 8 isoform X1
Refseq	XP_024024229.1	2e-51	protein REVEILLE 8 isoform X1
Refseq	XP_024024230.1	2e-51	protein REVEILLE 8 isoform X1
Refseq	XP_024024231.1	1e-51	protein REVEILLE 8 isoform X2
Refseq	XP_024024233.1	1e-51	protein REVEILLE 8 isoform X3
Swissprot	Q8RWU3	5e-46	RVE8_ARATH; Protein REVEILLE 8
TrEMBL	W9RLU7	6e-50	W9RLU7_9ROSA; Transcription factor ASG4
STRING	XP_010100834.1	1e-50	(Morus notabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2956	33	72

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G09600.2	5e-45	MYB_related family protein

Publications ? help Back to Top
Manfield IW, et al. Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis. Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9 [PMID:16845059] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Fogelmark K,Troein C Rethinking transcriptional activation in the Arabidopsis circadian clock. PLoS Comput. Biol., 2014. 10(7): p. e1003705 [PMID:25033214] Xing H, et al. LNK1 and LNK2 recruitment to the evening element require morning expressed circadian related MYB-like transcription factors. Plant Signal Behav, 2015. 10(3): p. e1010888 [PMID:25848708] Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size. Plant Physiol., 2017. 173(4): p. 2308-2322 [PMID:28254761]