PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PK02601.2

Organism

Cannabis sativa

Taxonomic ID

3483

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

G2-like

Protein Properties

Length: 107aa MW: 12468.4 Da PI: 10.132

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK02601.2	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	92.3	4e-29	53	107	1	56
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 kpr+ W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl+ PK02601.2 53 KPRVIWSLELHQKFVTAVNQL-GIDKAVPKKILHLMNVDNLTRENVASHLQKYRLY 107 79*****************.******************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50110	12.733	1	36	IPR001789	Signal transduction response regulator, receiver domain
Gene3D	G3DSA:3.40.50.2300	1.8E-9	4	53	No hit	No description
SuperFamily	SSF52172	1.9E-6	4	42	IPR011006	CheY-like superfamily
SuperFamily	SSF46689	1.06E-19	50	106	IPR009057	Homeodomain-like
PROSITE profile	PS51294	12.297	50	107	IPR017930	Myb domain
TIGRFAMs	TIGR01557	3.0E-25	53	106	IPR006447	Myb domain, plants
Gene3D	G3DSA:1.10.10.60	1.4E-29	54	107	IPR009057	Homeodomain-like
Pfam	PF00249	2.7E-8	58	105	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000160	Biological Process	phosphorelay signal transduction system
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 107 aa Download sequence Send to blast
MGXPKLVMKG ITEGACDYLL KPVRIEELKN IWKHVIRGKK NEFDDDEPST QKKPRVIWSL 60 ELHQKFVTAV NQLGIDKAVP KKILHLMNVD NLTRENVASH LQKYRLY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1irz_A	9e-25	49	106	1	58	ARR10-B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250\|UniProtKB:Q940D0}.
UniProt	Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250\|UniProtKB:Q940D0}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021640825.1	9e-49	LOW QUALITY PROTEIN: two-component response regulator ARR12-like
Swissprot	B8AEH1	2e-43	ORR23_ORYSI; Two-component response regulator ORR23
Swissprot	Q6K8X6	2e-43	ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBL	A0A1S3BUB4	5e-47	A0A1S3BUB4_CUCME; Two-component response regulator
TrEMBL	A0A445K107	5e-47	A0A445K107_GLYSO; Two-component response regulator
STRING	XP_008452870.1	9e-48	(Cucumis melo)
STRING	XP_004157093.1	1e-47	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF18475	3	5

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G31920.1	2e-44	response regulator 10

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]