PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK01212.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 146aa MW: 17082.9 Da PI: 10.0314 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.9 | 2e-17 | 22 | 67 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l ++v ++G+ +W+ Ia++++ gR++k+c++rw++ PK01212.1 22 RGHWRPGEDEKLRELVDRYGPQNWNFIAEHLQ-GRSGKSCRLRWYNQ 67 899*****************************.************96 PP | |||||||
2 | Myb_DNA-binding | 53.1 | 7.3e-17 | 74 | 118 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++T+eE+e+l+ a++ +G++ W+ Ia+++ gRt++ +k++++ + PK01212.1 74 KKPFTEEEEERLLAAHRIYGNK-WACIAKYFH-GRTDNAVKNHYHVV 118 689*******************.*********.***********976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 25.048 | 17 | 72 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.41E-30 | 20 | 115 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.6E-14 | 21 | 70 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.1E-27 | 23 | 75 | IPR009057 | Homeodomain-like |
Pfam | PF13921 | 6.2E-18 | 25 | 85 | No hit | No description |
CDD | cd00167 | 1.18E-11 | 25 | 66 | No hit | No description |
PROSITE profile | PS51294 | 18.966 | 73 | 123 | IPR017930 | Myb domain |
SMART | SM00717 | 1.4E-13 | 73 | 121 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.5E-21 | 76 | 121 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.04E-4 | 85 | 119 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MERSSSSMSS DHGGGGGKNC YRGHWRPGED EKLRELVDRY GPQNWNFIAE HLQGRSGKSC 60 RLRWYNQLDP NINKKPFTEE EEERLLAAHR IYGNKWACIA KYFHGRTDNA VKNHYHVVMA 120 RRKRERFSSS SSSPNSHHLI HNHNHN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-34 | 16 | 122 | 1 | 107 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269|PubMed:20305120}. | |||||
UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. | |||||
UniProt | INDUCTION: Induced by wounding. {ECO:0000269|PubMed:20305120}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010090845.2 | 1e-78 | transcription factor CSA | ||||
Swissprot | Q5NBM8 | 3e-58 | CSA_ORYSJ; Transcription factor CSA | ||||
Swissprot | Q6R0C4 | 5e-59 | MYB52_ARATH; Transcription factor MYB52 | ||||
TrEMBL | A0A2P5E8W7 | 3e-77 | A0A2P5E8W7_TREOI; MYB transcription factor | ||||
STRING | XP_010090845.1 | 2e-77 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF230 | 34 | 243 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G33450.1 | 1e-59 | myb domain protein 69 |