PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PK01183.1

Organism

Cannabis sativa

Taxonomic ID

3483

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

MYB_related

Protein Properties

Length: 63aa MW: 7130.81 Da PI: 8.2199

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK01183.1	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53	8e-17	18	62	1	45
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +g+WT eEd++l+++++ +G g W++ a+ g++Rt+k+c++rw+ PK01183.1 18 KGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWL 62 79******************************************6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	3.2E-19	11	61	IPR009057	Homeodomain-like
SuperFamily	SSF46689	7.25E-14	13	62	IPR009057	Homeodomain-like
PROSITE profile	PS51294	18.148	13	63	IPR017930	Myb domain
SMART	SM00717	8.0E-5	17	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.8E-15	18	62	IPR001005	SANT/Myb domain
CDD	cd00167	5.16E-9	20	61	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 63 aa Download sequence Send to blast
DYTRTCSGNS SEEVEVRKGP WTMEEDLILI NYIANHGEGV WNSLAKAAGL KRTGKSCRLR 60 WLX

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in photomorphogenesis in the light. May act downstream of the light receptor network and directly affects transcription of light-induced genes. In darkness, its probable degradation prevent the activation of light-induced genes. Required to activate expression of PAL. Acts redundantly with MYB24 and MYB57 to control stamen filament elongation in the late developed flowers. Contributes with MYB24 to induction of MYB108 by jasmonate. Repressed at the transcript levels by DELLA proteins. {ECO:0000269\|PubMed:11967090, ECO:0000269\|PubMed:16805732, ECO:0000269\|PubMed:19091873, ECO:0000269\|PubMed:19325888, ECO:0000269\|PubMed:21447791}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by jasmonate. {ECO:0000269\|PubMed:16805732}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015879077.1	2e-30	myb-related protein 305-like
Swissprot	Q9LK95	1e-28	MYB21_ARATH; Transcription factor MYB21
TrEMBL	A0A2P5BUN1	1e-30	A0A2P5BUN1_PARAD; MYB transcription factor
STRING	XP_008443525.1	9e-30	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF3305	34	69

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G27810.1	5e-31	myb domain protein 21

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Su Z, et al. Flower development under drought stress: morphological and transcriptomic analyses reveal acute responses and long-term acclimation in Arabidopsis. Plant Cell, 2013. 25(10): p. 3785-807 [PMID:24179129] Liu Z, et al. A Conserved Cytochrome P450 Evolved in Seed Plants Regulates Flower Maturation. Mol Plant, 2015. 8(12): p. 1751-65 [PMID:26388305] Chen X,Huang H,Qi T,Liu B,Song S New perspective of the bHLH-MYB complex in jasmonate-regulated plant fertility in arabidopsis. Plant Signal Behav, 2016. 11(2): p. e1135280 [PMID:26829586] Huang H, et al. Arabidopsis MYB24 Regulates Jasmonate-Mediated Stamen Development. Front Plant Sci, 2017. 8: p. 1525 [PMID:28928760]