PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK01153.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 74aa MW: 8411.34 Da PI: 10.6112 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 61.6 | 1.6e-19 | 28 | 70 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T+eEd +++a++ +G++ W+tIar ++ gRt++ +k++w++ PK01153.2 28 PFTPEEDSMIIQAHAAHGNK-WATIARLLP-GRTDNAIKNHWNST 70 89******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 1.88E-23 | 8 | 72 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 5.4E-8 | 9 | 33 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 23.18 | 21 | 74 | IPR017930 | Myb domain |
SMART | SM00717 | 2.1E-14 | 25 | 73 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.04E-13 | 28 | 71 | No hit | No description |
Pfam | PF00249 | 7.8E-17 | 28 | 70 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.3E-23 | 34 | 71 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 74 aa Download sequence Send to blast |
XRVRPSYGGK SCRLRWCNQL CPSVQHRPFT PEEDSMIIQA HAAHGNKWAT IARLLPGRTD 60 NAIKNHWNST LQIG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 3e-24 | 9 | 72 | 39 | 102 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008369404.1 | 5e-38 | transcription factor MYB73-like | ||||
Swissprot | Q9SN12 | 5e-33 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | A0A392NFN6 | 2e-36 | A0A392NFN6_9FABA; Transcription factor MYB44-like (Fragment) | ||||
TrEMBL | A0A498JGK3 | 1e-36 | A0A498JGK3_MALDO; Uncharacterized protein | ||||
STRING | XP_008369404.1 | 2e-37 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF11600 | 29 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50060.1 | 2e-35 | myb domain protein 77 |
Publications ? help Back to Top | |||
---|---|---|---|
|