PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK00728.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Nin-like
Protein Properties Length: 962aa    MW: 105715 Da    PI: 4.9772
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK00728.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.82.6e-29596647152
     RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                aek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  PK00728.1 596 AEKNVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 647
                589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.859581667IPR003035RWP-RK domain
PfamPF020422.5E-26599647IPR003035RWP-RK domain
SuperFamilySSF542772.91E-22860946No hitNo description
PROSITE profilePS5174520.672862944IPR000270PB1 domain
SMARTSM006663.0E-20862944IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.4E-24862944No hitNo description
PfamPF005642.7E-17865943IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 962 aa     Download sequence    Send to blast
MEPFSPKEGD NDYWSSPSEQ VESFPSFDGV PRDMLSEDVF NSFSELLSFD TYVGWSSNPA  60
VTDQVSATYG LASLPPTIYT PQNTSDFIEQ TVEALPVAEV GGNLDLPRGS FNYGDKAVFL  120
PEDTQLEASA HSNNGSDLVA TQNTDFLENG EMDVENSTVP RPVRLSLDEK MLKALSFVKA  180
SSGMGILAQV WVPVRRGDEL LLSTSDQPYL LDNMLVGYRE VSRRFTFSVE GKQGCVLGLP  240
GRVFQSKIPE WTSNVAYYKK NEYVRVEHAY NHQVRGCIAL PVCEPDLGVT CCAVLEIVTT  300
NEKPNFDAEI EIVCNALQAV NLKMSQPLRL NPQCLSKNQK DALAEIIDVL RAVCHAHRLP  360
LALTWIPCNS EGTSNEVAGV CVGDGKTSST EKCILCVEKA ACYVNDRLMQ GFASACVEHH  420
LEVGQGLAGK ALQSNLPFFF PDVKTYDISD YPLVHHARKF GLNAAVAIRL RSTYTGDCDY  480
ILEFFLPVNM KGASEQQLLL NNLSGTMQRI CKSLRTVSDV EIGIASHDTF KEDSVPNFIP  540
LPGESSNMVQ LDGDLNSTNE VPLKLAERRN EAHKVDNVHE QPRGTRWQAE KKRSTAEKNV  600
SLSVLQQYFS GSLKDAAKSI GVCPTTLKRI CRQHGISRWP SRKINKVNRS LKKIQTVLDS  660
VQGVEGGLKF DPTTGGLVAA GSISQEYESQ KKIASLQNLD PSFTVKLEED ECYTDGVNLN  720
SYKIRKPNII APTNSNKDSK IAIEAGSKPI SGTFSEKISL GSYPATEGMT SSHSKCSSKF  780
ENSDARHVSR NSSSLAVGDE MDTSEDGEDD ELLQHNQPAS SSMTDSSNGC GSLLHGSSSS  840
SQSFEERKHP KGKASCADSY SKIIVKATYK EDTVRFKFDT SAGCYQLYEE VAKRFKLHTG  900
AFQLKYLDDE EEWVMLVSDM DLQECLEILD DVGTRSVKFQ VRDMPCVVGS SGSSNCFLPG  960
GT
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024031921.10.0protein NLP8
RefseqXP_024031922.10.0protein NLP8
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLA0A2P5G0I90.0A0A2P5G0I9_TREOI; NIN-like transcription factor
STRINGXP_010112531.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein
Publications ? help Back to Top
  1. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]