PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10027922m | ||||||||
Common Name | CARUB_v10027922mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | Nin-like | ||||||||
Protein Properties | Length: 84aa MW: 9712.75 Da PI: 10.8518 | ||||||||
Description | Nin-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | RWP-RK | 71.2 | 1.4e-22 | 2 | 41 | 13 | 52 |
RWP-RK 13 yFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 F+lpi+ AAk++++c+TvLK+iCR+ ++RWPhRkiksl Carubv10027922m 2 LFHLPIETAAKQMNICPTVLKKICRKGSLMRWPHRKIKSL 41 6*************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51519 | 15.289 | 1 | 62 | IPR003035 | RWP-RK domain |
Pfam | PF02042 | 8.6E-20 | 2 | 41 | IPR003035 | RWP-RK domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 84 aa Download sequence Send to blast |
MLFHLPIETA AKQMNICPTV LKKICRKGSL MRWPHRKIKS LQTKIMSLKK LHTAAKDDEV 60 NVEIERLQRR IDKICSDALK NMK* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Carubv10027922m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006281616.2 | 1e-51 | uncharacterized protein LOC17875321 | ||||
TrEMBL | R0GU10 | 2e-53 | R0GU10_9BRAS; Uncharacterized protein | ||||
STRING | XP_006281760.1 | 4e-54 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4076 | 23 | 42 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G18790.1 | 4e-13 | RWP-RK domain-containing protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10027922m |
Entrez Gene | 17874839 |