PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10025737m
Common NameCARUB_v10025737mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family HB-other
Protein Properties Length: 1708aa    MW: 192370 Da    PI: 4.9144
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10025737mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.4e-182480157
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                     ++kR   t+ qle+Le+ +  ++yps++ r++L+ kl+L++rq ++WF+ rR k++k
  Carubv10025737m 24 KSKRKMKTAAQLEVLENTYSAEPYPSEAIRADLSVKLNLSDRQLQMWFCHRRLKDRK 80
                     679****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-17780IPR009057Homeodomain-like
SuperFamilySSF466895.56E-151880IPR009057Homeodomain-like
PROSITE profilePS5007116.392181IPR001356Homeobox domain
SMARTSM003898.3E-162385IPR001356Homeobox domain
CDDcd000864.71E-132481No hitNo description
PfamPF000461.2E-152480IPR001356Homeobox domain
PROSITE profilePS5082715.925525584IPR018501DDT domain
SMARTSM005713.4E-22525584IPR018501DDT domain
PfamPF027911.5E-16526581IPR018501DDT domain
PfamPF050666.3E-15706774IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156128.2E-4909947IPR028942WHIM1 domain
PfamPF156133.1E-1310821154IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1708 aa     Download sequence    Send to blast
MEGGGSDEAE KNKTTPEGGG SESKSKRKMK TAAQLEVLEN TYSAEPYPSE AIRADLSVKL  60
NLSDRQLQMW FCHRRLKDRK STTPSKRQRK ELVTPMAVES SVNAGDLVAG NEFDSKRAVR  120
GSGSGGGVTV VRRFNEPSSA EVRAVGYVEA QLGERLRDNG PILGMEFDPL PPGAFGMPIE  180
MPSHRKATRQ AFETSLYVRP DVKPSKDHAR PIREYQFLPD LPSSRTDHSE RVSPSHHFGV  240
PIDASVMRAS AVSVGHRDDY KISPQIPNLN LATHQGKAGH VYSPNLSEYD SPYQKGYMDA  300
AAHRNLNDHP IHEDHFVKSE REVGNEDEED DALQLERKRK NEEARISREV EAHEKRIRRE  360
LEKQDLLRRK REEQIRKEME RQDRERRKEE ERLLREKQRE EERFMKEQMR ELQRREKFLK  420
KETMRAEKMR QKEEMRREKE VARLKAANER AIARKIAKES MELIEDERLE LMEVAALAKG  480
LPSMLALDFE TLQNLDEYRD KQVLFPPTSV KLKKPFTVKP WNGSDENVAN LLMVWRFLIT  540
FADVLGLWPF TLDEFAQSFH DYDPRLMGEI HIVLLKTIIK DIEGVTRTLL TGVGANQTAS  600
NPGGGHPHVV EGAYAWGFDI RSWRRNLNVF TWPEILRQLA VSAGLGPQLK KKNIKTLSVH  660
DENEANNSEN VILNLRKGVT AENAFAKMQE KGLSNPRRSR HRLTPGTVKF AAFHVLSIEG  720
EKGLTILEVA DKIQNSGLRD LTTSRTPEAS VAAALSRDTK LFERVAPSTY CVRASYRKDA  780
GDAETIFAEA RERIRAFKSG ITDVEDVDDA ERDEDSESDV GDDPEVDLNL KKEDPVAMEI  840
ENSIKVEPVL ENGKLDTMTM KTKPGLPLTP SLPEDMKDEK RDDILADQSL EDAVANDEES  900
ACFDESKLGE QWVQGLVEGD YSNLSSEERL NGLVALIGIA IEGNTIRIAL EERLEVASAL  960
KKQMWGEVQL DKRWKEESLM RANFLSYPTA KPGLNIATPA SGNQESSSAD VTPISSQDPL  1020
SLPQTDVNNV IAGPSLQLQE NVSGMENLQY QQQQGYTADR ERLRAQLKAY VGYKAEELYV  1080
YRSLPLGQDR RRNRYWRFSA SASRNDPGCG RIFVELQDGR WRLIDSKEDF DYLVKSLDVR  1140
GVRESHLHFM LLKIEASFKE AVRRNVEANP GLCSISSCLD SDTAEISTTF KIELGDHNNI  1200
ERCSVLQRFQ SFEKWMWDNM LHPGALSAFK YGAKQSSPLF RICRICAELH FVEDICCPSC  1260
GQMRAGPDVG ELCFAEQVAQ LCDNSRGGDA GFILRSSISS PLRIRLLKIQ LALVEASLPP  1320
EGLEAFWTEN VRKSWGLKLL SSSSPEELNQ VLTTLEVAVK RDFLSPNFET TSELLGLPEE  1380
ALANDFTCVV NVLPWIPKTT GGVALRLFDF DSSVVYTPDQ NNDPLKDKES EDFVGLEPDF  1440
MSNVQEKNVM ETPVQVAYTQ EENWTDPGLG GVSSSGRGGR PPRGRGRPRS RGNGKKPTVS  1500
GKPPRGAANS NGETMSRPRA QPRSRKNGRR SGTKGRTRPT QGTLGISNEV EVKRRDKEGA  1560
VTAKTTLPDN DDDWIETPEL QEDDGEASSS GRSFQYKDYD DDEVMAPIDD FDDGGESSKL  1620
VGRGEFSLHS DDEYEEEEEE EEEEEEEEEE DMNTKMNANV VDEDEDYIND DSYGTREQPV  1680
ISNNDAARKR FAFDDPDLTS SSSSDYR*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC (PubMed:22694359). Involved in the transcriptional regulation of seed-specific gene expression (PubMed:23872538). {ECO:0000269|PubMed:22694359, ECO:0000269|PubMed:23872538}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10025737m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0052390.0AB005239.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MLN1.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006279558.10.0homeobox-DDT domain protein RLT2
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLR0EUK20.0R0EUK2_9BRAS; Uncharacterized protein
STRINGXP_006279558.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96012530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator