PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10022005m | ||||||||
Common Name | CARUB_v10022005mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 257aa MW: 30106.3 Da PI: 8.5778 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.1 | 7.5e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr+g+lKKA+E+SvLCdaeva+++fs++gkl+eys+ Carubv10022005m 9 KRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALVVFSHKGKLFEYST 59 79***********************************************96 PP | |||||||
2 | K-box | 107.4 | 1.6e-35 | 79 | 174 | 5 | 100 |
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 + + e+ + +++ e+++Lk++ie L+r+qRh+lGedL+ +s keLq+LeqqL+++lk+iRs+Kn+l++e+i++lq+kek++qe+n +L+k++ Carubv10022005m 79 QLIAPESDVNTNWSMEYNRLKAKIELLERNQRHYLGEDLQAMSPKELQNLEQQLDTALKHIRSRKNQLMYESINDLQRKEKAIQEQNSMLSKQI 172 555556667889*********************************************************************************9 PP K-box 99 ee 100 +e Carubv10022005m 173 KE 174 87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.8E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.184 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.89E-42 | 2 | 79 | No hit | No description |
SuperFamily | SSF55455 | 6.28E-34 | 2 | 89 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.5E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 9.2E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.5E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.5E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.5E-30 | 85 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 16.969 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009933 | Biological Process | meristem structural organization | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 257 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRAGLLK KAHEISVLCD AEVALVVFSH KGKLFEYSTD 60 SCMEKILERY ERYSYAERQL IAPESDVNTN WSMEYNRLKA KIELLERNQR HYLGEDLQAM 120 SPKELQNLEQ QLDTALKHIR SRKNQLMYES INDLQRKEKA IQEQNSMLSK QIKEREKILR 180 AQQEQWDQQN NGHNVPPPPP PQQHQIQHPY MLSHQPSPFL NMGGLYQEED PMAMRRNDLD 240 LSLEPVYNCN LGCFAA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 7e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 7e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 7e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 7e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 8e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 8e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 8e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 8e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00096 | ChIP-seq | Transfer from AT1G69120 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Carubv10022005m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU551760 | 0.0 | EU551760.1 Capsella bursa-pastoris APETALA1-like protein (AP1a) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006301567.1 | 0.0 | floral homeotic protein APETALA 1 | ||||
Swissprot | P0DI14 | 0.0 | AP1_BRARP; Floral homeotic protein APETALA 1 | ||||
TrEMBL | R0I8Q6 | 0.0 | R0I8Q6_9BRAS; Uncharacterized protein | ||||
STRING | XP_006301567.1 | 0.0 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM792 | 25 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 1e-164 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10022005m |
Entrez Gene | 17894685 |