PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10019214m | ||||||||
Common Name | CARUB_v10019214mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 110aa MW: 12647.4 Da PI: 10.379 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 82.9 | 7.8e-26 | 36 | 94 | 13 | 71 |
TCP 13 TkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssas 71 T+ R RR+Rl+++caa++F+L++eLGf++d++t+ WLl++a+pai +++g + ++ s Carubv10019214m 36 TSSKERHRRIRLPVTCAAQVFQLTKELGFKTDGQTVGWLLRNAEPAILAAMGHGLDTTS 94 89999***********************************************9444442 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51369 | 17.548 | 29 | 85 | IPR017887 | Transcription factor TCP subgroup |
Pfam | PF03634 | 1.1E-21 | 29 | 94 | IPR005333 | Transcription factor, TCP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 110 aa Download sequence Send to blast |
MYHTCSLPLT LTKERTRPKE MDLRNNTERK ARRTPTSSKE RHRRIRLPVT CAAQVFQLTK 60 ELGFKTDGQT VGWLLRNAEP AILAAMGHGL DTTSDETSNH FIHSYMNIHN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Required during early processes in pollen development. {ECO:0000269|PubMed:16786299}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Carubv10019214m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006292943.2 | 4e-77 | transcription factor TCP16 | ||||
Swissprot | Q9M1U4 | 8e-27 | TCP16_ARATH; Transcription factor TCP16 | ||||
TrEMBL | R0FTM7 | 3e-77 | R0FTM7_9BRAS; Uncharacterized protein (Fragment) | ||||
STRING | XP_006292943.1 | 5e-78 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM16163 | 5 | 10 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G45150.1 | 3e-29 | TCP domain protein 16 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10019214m |
Entrez Gene | 17885870 |
Publications ? help Back to Top | |||
---|---|---|---|
|