PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10018979m | ||||||||
Common Name | CARUB_v10018979mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 122aa MW: 13601.7 Da PI: 8.3951 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 132.9 | 1.3e-41 | 5 | 104 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 +CaaCk+lrr+C+kdC+++pyfp ++p+kfa++h+++Ga nv+k+l++lpe++r +a++sl++eA++r++dPvyG+vg+i+ lq q++++++el Carubv10018979m 5 RCAACKYLRRRCPKDCIFSPYFPPNDPAKFACIHRIYGAGNVSKMLQQLPEQTRAEAVESLCFEAKCRVDDPVYGCVGIISLLQTQIQNTQNEL 98 6********************************************************************************************* PP DUF260 95 allkee 100 a++++e Carubv10018979m 99 AKVQAE 104 **9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 24.358 | 4 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 4.9E-41 | 5 | 102 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0016020 | Cellular Component | membrane |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MNPKRCAACK YLRRRCPKDC IFSPYFPPND PAKFACIHRI YGAGNVSKML QQLPEQTRAE 60 AVESLCFEAK CRVDDPVYGC VGIISLLQTQ IQNTQNELAK VQAEVAVAQT KLSQNQNSDF 120 M* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-38 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-38 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Carubv10018979m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB473846 | 1e-151 | AB473846.1 Arabidopsis thaliana ASL13 mRNA for ASYMMETRIC LEAVES2-like 13 protein, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006292728.1 | 2e-86 | LOB domain-containing protein 24 | ||||
Swissprot | P59468 | 6e-82 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | R0FT52 | 5e-85 | R0FT52_9BRAS; Uncharacterized protein | ||||
STRING | XP_006292728.1 | 9e-86 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 2e-84 | LOB domain-containing protein 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10018979m |
Entrez Gene | 17886183 |