PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10018528m | ||||||||
Common Name | CARUB_v10018528mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 103aa MW: 11781 Da PI: 9.0528 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 91.8 | 8.3e-29 | 3 | 92 | 11 | 100 |
DUF260 11 kCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100 +C ++Cv+apy+p ++p+k+a + k+F +sn+ k++ +++++++++ ++s ++eAe r+rdPv G+vgvi+kl++ql+ lk +l+ +k+e Carubv10018528m 3 TCIEECVFAPYLPGNKPEKYATLSKVFNMSNIAKIVMSIEPSQKQACVDSFCFEAETRIRDPVMGCVGVIRKLERQLQDLKLKLKIAKKE 92 7***********************************************************************************999987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 18.551 | 1 | 93 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 8.6E-28 | 3 | 90 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
MHTCIEECVF APYLPGNKPE KYATLSKVFN MSNIAKIVMS IEPSQKQACV DSFCFEAETR 60 IRDPVMGCVG VIRKLERQLQ DLKLKLKIAK KELAALQEIH RRN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-25 | 4 | 93 | 22 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-25 | 4 | 93 | 22 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Carubv10018528m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019101899.1 | 8e-32 | PREDICTED: LOB domain-containing protein 6-like | ||||
TrEMBL | R0HJ33 | 2e-70 | R0HJ33_9BRAS; Uncharacterized protein (Fragment) | ||||
STRING | XP_006292317.1 | 4e-71 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G65620.4 | 3e-24 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10018528m |
Entrez Gene | 17885420 |