PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10012424m
Common NameCARUB_v10012424mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family ARF
Protein Properties Length: 521aa    MW: 58657.8 Da    PI: 6.951
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10012424mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B366.63.7e-21126227199
                      EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                      f k+lt sd++++g l++pk+ a+e+     + ++  ++++  +d++  +W++k+++r++++r++lt+GW+ F   + L +gD +++   + ++
  Carubv10012424m 126 FMKILTASDTSTHGGLSVPKRSATEClppldMAIPVPTQDILTKDLHDSVWKFKHSFRGTPQRHLLTTGWSAFITTKSLVAGDAFILL--RGET 217
                      89****************************9555666679***********************************************9..4499 PP

                      E..EEEEE-S CS
               B3  90 felvvkvfrk 99 
                      +el+v+++r+
  Carubv10012424m 218 GELRVGIRRA 227
                      99******97 PP

2Auxin_resp97.12.5e-32252331183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a ha++++++F+vv++Pr+  s+F+v+++k+++a+++k+ vG+Rf m+fe ed+se+r+sGt++gv +++p +W++S+WrsL+
  Carubv10012424m 252 ALHAFHNQCMFTVVFKPRS--SQFIVNYDKFLDAVNNKFNVGSRFTMRFEAEDFSEKRYSGTIIGVGNFSP-HWKDSEWRSLQ 331
                      6799**************6..9*************************************************.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.106.3E-34115238IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.49E-29120240IPR015300DNA-binding pseudobarrel domain
CDDcd100172.59E-19125226No hitNo description
SMARTSM010191.7E-18126228IPR003340B3 DNA binding domain
PROSITE profilePS5086311.984126228IPR003340B3 DNA binding domain
PfamPF023627.5E-19126227IPR003340B3 DNA binding domain
PfamPF065074.4E-29252331IPR010525Auxin response factor
PROSITE profilePS5174521.545425506IPR000270PB1 domain
SuperFamilySSF542771.96E-9429501No hitNo description
PfamPF023097.3E-6471510IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MDGCNVANVQ PDLSGTFNGS ESYMSEQLWK LCAGPLCHLP NLRDKVYYFP QGHIELVEAA  60
TREELNQIQS NFDLPSKLEC RVISVRLKAE KNTDQVYAEI TLIPDARQVV IPTQNDSQYR  120
PKVNSFMKIL TASDTSTHGG LSVPKRSATE CLPPLDMAIP VPTQDILTKD LHDSVWKFKH  180
SFRGTPQRHL LTTGWSAFIT TKSLVAGDAF ILLRGETGEL RVGIRRARHQ QGNITSPLVS  240
TENMRHGVIA SALHAFHNQC MFTVVFKPRS SQFIVNYDKF LDAVNNKFNV GSRFTMRFEA  300
EDFSEKRYSG TIIGVGNFSP HWKDSEWRSL QVQWDELASF PRPEKVSPWE IEHIPSSSNV  360
PQSSLLIKNK RSRHVNEIGS SSFSPHLLPP ILTQNPEVVQ PSMANEGGTS FRLFGVSLVV  420
PFGKNESYQV QMQGVTVGRA LDLSVLNGYD QLIHELEKLF DLPGELRSRN QWEMVFTDHE  480
GDVVLMGDVP WLEFCNMVKK ILICSKEEVN KLKSETNLPN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1232435919360Auxin response factor 1
4ldw_A1e-1232435919360Auxin response factor 1
4ldw_B1e-1232435919360Auxin response factor 1
4ldx_A1e-1232435919360Auxin response factor 1
4ldx_B1e-1232435919360Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10012424m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023646043.10.0putative auxin response factor 14
SwissprotQ9LQE80.0ARFN_ARATH; Putative auxin response factor 14
TrEMBLR0IH470.0R0IH47_9BRAS; Auxin response factor
STRINGXP_006304807.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35540.10.0auxin response factor 14