PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10011014m | ||||||||
Common Name | CARUB_v10011014mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 258aa MW: 29727.6 Da PI: 7.0194 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.9 | 2e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd +l+ ++++lG +W++ +r+ g++R++k+c++rw++yl Carubv10011014m 14 KGEWTAEEDRRLIAYINELGITDWRSLPRRAGLNRCGKSCRLRWLNYL 61 799*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 56.3 | 7.1e-18 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T++Ede +++ ++ lG++ W++Ia+ m+ +Rt++++k++w++ Carubv10011014m 67 RGKFTPQEDEAIIKFHAFLGNR-WAAIAQLMQ-NRTDNDIKNHWNSC 111 89********************.*********.***********975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.426 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.71E-29 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.8E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.6E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.0E-22 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.22E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.646 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 2.8E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.1E-16 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.45E-9 | 69 | 109 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.6E-25 | 69 | 116 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 258 aa Download sequence Send to blast |
MGRKTWFDVA GMKKGEWTAE EDRRLIAYIN ELGITDWRSL PRRAGLNRCG KSCRLRWLNY 60 LRPGIRRGKF TPQEDEAIIK FHAFLGNRWA AIAQLMQNRT DNDIKNHWNS CLKKRLERNG 120 INPMTHEPII KHLTVKTNKE DFGSTSTTTS SSMESSPSSG SARILNKLAA GISSRQHSLD 180 RIKYILSNPI IISSDQVEEG RELDMDHKID GGEEEDDIQI WDEEEVRRLM GIHVMDYEMT 240 SYDSVMYEST HILDHLF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-26 | 9 | 117 | 2 | 109 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. | |||||
UniProt | Involved in the control of epidermal cell morphogenesis in petals. Promotes unidirectional cell expansion once outgrowth has been initiated (PubMed:17376813). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). Functions as a major regulator of cuticle formation in vegetative organs by regulating the cuticle biosynthesis genes CYP86A8/LCR and CER1 (PubMed:24169067). {ECO:0000269|PubMed:17376813, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Carubv10011014m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006303555.1 | 0.0 | transcription factor MYB34 | ||||
Swissprot | Q9LE63 | 2e-54 | MY106_ARATH; Transcription factor MYB106 | ||||
Swissprot | Q9LXF1 | 1e-54 | MYB16_ARATH; Transcription factor MYB16 | ||||
TrEMBL | R0IHV4 | 0.0 | R0IHV4_9BRAS; Uncharacterized protein | ||||
STRING | XP_006303555.1 | 0.0 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G18710.1 | 1e-118 | myb domain protein 47 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10011014m |
Entrez Gene | 17898586 |
Publications ? help Back to Top | |||
---|---|---|---|
|