PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10006513m
Common NameCARUB_v10006513mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family ARF
Protein Properties Length: 684aa    MW: 77439.3 Da    PI: 5.8964
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10006513mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.92.2e-24126227199
                      EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      f kvlt sd++++g +++ +k+a+e+       +  ++ +++l+ ed +g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + 
  Carubv10006513m 126 FSKVLTASDTSTHGGFSVLRKHATEClppldmtQ--QTPTQELVAEDVHGYQWKFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFL--RG 215
                      88****************************9643..445569************************************************..44 PP

                      SEE..EEEEE-S CS
               B3  88 sefelvvkvfrk 99 
                      +++el+v+v+r+
  Carubv10006513m 216 ENGELRVGVRRA 227
                      9999******97 PP

2Auxin_resp1111.2e-36252331183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a ha++ k++F v+Y+Pr+  s+F+++++k+++a+++k+svGmRfkm+fe+eds+err+sGtv+gv+d++p +W++SkWr+L+
  Carubv10006513m 252 ACHATQAKTMFIVYYKPRT--SQFIISLNKYLEAMDNKFSVGMRFKMRFEGEDSPERRYSGTVIGVKDCSP-HWKDSKWRCLE 331
                      6799**************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.62E-39117255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.6E-42119241IPR015300DNA-binding pseudobarrel domain
CDDcd100176.63E-21124226No hitNo description
PROSITE profilePS5086312.731126228IPR003340B3 DNA binding domain
SMARTSM010194.6E-24126228IPR003340B3 DNA binding domain
PfamPF023624.0E-22126227IPR003340B3 DNA binding domain
PfamPF065071.6E-32252330IPR010525Auxin response factor
PROSITE profilePS5174523.091568660IPR000270PB1 domain
PfamPF023092.8E-5572604IPR033389AUX/IAA domain
SuperFamilySSF542772.55E-10573644No hitNo description
PfamPF023091.6E-6609656IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
NDGVGQTILA EVSNETSECL YDELWKLCAG PLVDVPQAGE RVYYFPQGHM EQLEASTRQD  60
LNTRKPLFDL PPKILCNVMN VRLQAEKDTD EVYAQITLIP VGTEVDEPMS PDTSPPETQK  120
PKVHSFSKVL TASDTSTHGG FSVLRKHATE CLPPLDMTQQ TPTQELVAED VHGYQWKFKH  180
IFRGQPRRHL LTTGWSTFVT SKRLVAGDTF VFLRGENGEL RVGVRRANRQ QSSMPSSVIS  240
SHSMHLGVLA TACHATQAKT MFIVYYKPRT SQFIISLNKY LEAMDNKFSV GMRFKMRFEG  300
EDSPERRYSG TVIGVKDCSP HWKDSKWRCL EVHWDEPASI PRPDKVSPWE IEPFVTSESV  360
PQSVMVKNKR PRQFSEVSAL DVGITASNLW SSVLSQSHEF AQSCITSQRS PSQQCYRDST  420
EDAKKSDWLN NSYSVSNVSK ESTLNDQMIS PVEQKKPETT ATYRLFGIDL MSPIEEKTAP  480
MRPINITTPT MDSNSDPKSG ISKVPEEKKQ EPAQTSPKEV QSKQNSSTRS RTKIYISTRP  540
WRSVIHEFQI KYTSVYDVCG IEHDPDSVID EQVQMQGVPV GRAVDLAALN GYNELIEDLE  600
KLFDIKGELQ SRNQWEVVFT DDEGDMMLVG DDPWPEFCNM VKRIFIWSKE EVKKMTPGNQ  660
LRMMLTEVET TFTTTSKTDN HSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1651735416355Auxin response factor 1
4ldw_A1e-1651735416355Auxin response factor 1
4ldw_B1e-1651735416355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10006513m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0821760.0AF082176.1 Arabidopsis thaliana auxin response factor 9 (ARF9) mRNA, complete cds.
GenBankAF3443120.0AF344312.1 Arabidopsis thaliana clone C00029 (e) auxin response factor 9 (At4g23980) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023634150.10.0auxin response factor 9
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLR0F8V90.0R0F8V9_9BRAS; Auxin response factor (Fragment)
STRINGXP_006285168.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9