PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001279m
Common NameCARUB_v10001279mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family CO-like
Protein Properties Length: 356aa    MW: 39542 Da    PI: 6.3162
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001279mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box35.22.6e-115297342
         zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                      r+C+ +e+ ++ +fC+ +   lC  C +e+H+       H++vp+
  Carubv10001279m 52 VRVCQSCERAPAAFFCKADAASLCIACDSEIHSAnplarrHQRVPI 97
                     689*****************************66899999**9997 PP

2CCT66.38.4e-23286330145
              CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                      Rea++lRY+eK+k RkFeK+irY+sRKa+Ae+RpR+KGrF+k++e
  Carubv10001279m 286 REARVLRYREKKKMRKFEKTIRYASRKAYAEKRPRIKGRFAKRNE 330
                      9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.381754IPR000315B-box-type zinc finger
SMARTSM003368.2E-6754IPR000315B-box-type zinc finger
CDDcd000212.28E-71254No hitNo description
PROSITE profilePS5011912.1735097IPR000315B-box-type zinc finger
PfamPF006436.7E-95297IPR000315B-box-type zinc finger
CDDcd000213.34E-95397No hitNo description
SMARTSM003361.7E-115597IPR000315B-box-type zinc finger
PROSITE profilePS5101716.559286328IPR010402CCT domain
PfamPF062037.6E-17286328IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009909Biological Processregulation of flower development
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MLKEESNWAQ ACDSCRSAAC TVYCHADSAY LCTSCDAQIH AVNCLASRHE RVRVCQSCER  60
APAAFFCKAD AASLCIACDS EIHSANPLAR RHQRVPILPI SGNSYGSMET NHSCETTVTE  120
PENSLVVGQE EEDRDEAEAA SWLLPNLGKN NGNNHSQNFS IGDEYLDLVD YSSSMEKQFT  180
DQSNQYQQPC NVPERSYRGD GVVPLQVDES RGHMHHGQHN LELGITYAPR SSNGSISHMV  240
HVSSMDLIVV PESTTSDATV SQPRSPKAVT DQLTEPPPQM LSPVEREARV LRYREKKKMR  300
KFEKTIRYAS RKAYAEKRPR IKGRFAKRNE ADAEADQTFS TTITFDTGYG IVPSL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1293299REKKKMR
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that may be involved in the light input to the circadian clock but does not affect flowering time.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10001279m
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288045.10.0zinc finger protein CONSTANS-LIKE 1
SwissprotO500550.0COL1_ARATH; Zinc finger protein CONSTANS-LIKE 1
TrEMBLR0HBC40.0R0HBC4_9BRAS; Uncharacterized protein
STRINGXP_006288045.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15850.11e-179CONSTANS-like 1
Publications ? help Back to Top
  1. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]
  2. An C, et al.
    Mediator subunit MED25 links the jasmonate receptor to transcriptionally active chromatin.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(42): p. E8930-E8939
    [PMID:28973940]
  3. Ordoñez-Herrera N, et al.
    The Transcription Factor COL12 Is a Substrate of the COP1/SPA E3 Ligase and Regulates Flowering Time and Plant Architecture.
    Plant Physiol., 2018. 176(2): p. 1327-1340
    [PMID:29187570]