PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_8916_iso_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 143aa MW: 16435.7 Da PI: 10.272 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 60 | 3.9e-19 | 44 | 96 | 4 | 56 |
-SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 +++f ++q++ Le+ Fe + p + +++LA+klgL+ rqV +WFqN+Ra+ k cra_locus_8916_iso_1_len_1705_ver_3 44 KRRFDDTQVRSLETIFETEARPELRVKQQLANKLGLQPRQVAIWFQNKRARSK 96 568************************************************99 PP | |||||||
2 | HD-ZIP_I/II | 110.6 | 1.1e-35 | 44 | 132 | 3 | 91 |
HD-ZIP_I/II 3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkee 76 krr+ + qv++LE+ Fe+e + e + K++la++Lglqprqva+WFqn+RAR k+kq+E++y++Lk++yd+l+++ cra_locus_8916_iso_1_len_1705_ver_3 44 KRRFDDTQVRSLETIFETEARPELRVKQQLANKLGLQPRQVAIWFQNKRARSKSKQIEREYNVLKASYDSLASK 117 9************************************************************************* PP HD-ZIP_I/II 77 nerLekeveeLreel 91 e+L+ke+e+L ++ cra_locus_8916_iso_1_len_1705_ver_3 118 YESLKKENESLLIQV 132 **********98776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 2.4E-17 | 29 | 99 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 16.309 | 38 | 98 | IPR001356 | Homeobox domain |
SMART | SM00389 | 7.8E-15 | 40 | 102 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 1.6E-16 | 44 | 96 | IPR001356 | Homeobox domain |
CDD | cd00086 | 2.70E-12 | 44 | 99 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.5E-17 | 45 | 105 | IPR009057 | Homeodomain-like |
PRINTS | PR00031 | 1.8E-5 | 69 | 78 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 73 | 96 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 1.8E-5 | 78 | 94 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 3.9E-16 | 98 | 133 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MFERSSAAAS APKASAWTVQ FPLNEMEVGL QSISATAYGK HGSKRRFDDT QVRSLETIFE 60 TEARPELRVK QQLANKLGLQ PRQVAIWFQN KRARSKSKQI EREYNVLKAS YDSLASKYES 120 LKKENESLLI QVNIVFYNTF KEI |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:15604708, ECO:0000269|PubMed:8771791}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027081733.1 | 3e-52 | homeobox-leucine zipper protein ATHB-12-like | ||||
Refseq | XP_027183124.1 | 3e-52 | homeobox-leucine zipper protein ATHB-12-like | ||||
Swissprot | P46897 | 7e-33 | ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7 | ||||
TrEMBL | A0A068UX97 | 3e-54 | A0A068UX97_COFCA; Uncharacterized protein | ||||
STRING | XP_009796883.1 | 1e-45 | (Nicotiana sylvestris) |
Publications ? help Back to Top | |||
---|---|---|---|
|