PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_8899_iso_2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 153aa MW: 16993.4 Da PI: 8.8238 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.8 | 1.2e-18 | 37 | 84 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT Ed +lv++v+++G g+W+++ ++ g+ R++k+c++rw ++l cra_locus_8899_iso_2_len_607_ver_3 37 KGPWTSAEDAILVEYVTKHGEGNWNAVQKHSGLARCGKSCRLRWANHL 84 79******************************************9996 PP | |||||||
2 | Myb_DNA-binding | 25.1 | 4.1e-08 | 90 | 120 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g++T++E+ +++++++++G++ W++ a+++ cra_locus_8899_iso_2_len_607_ver_3 90 KGAFTADEERRIIELHAKMGNK-WARMAAEVC 120 799*******************.*****9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 22.346 | 32 | 88 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-24 | 35 | 87 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-13 | 36 | 86 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.6E-16 | 37 | 84 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 6.68E-25 | 38 | 114 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.17E-11 | 39 | 84 | No hit | No description |
PROSITE profile | PS50090 | 6.284 | 85 | 124 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 8.5E-14 | 88 | 120 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.0E-4 | 89 | 133 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.2E-7 | 90 | 121 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 0.00622 | 92 | 127 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0043068 | Biological Process | positive regulation of programmed cell death | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0045926 | Biological Process | negative regulation of growth | ||||
GO:0048235 | Biological Process | pollen sperm cell differentiation | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MTRENEDQMV NKGGISSPSA EEGSGGGNVG GSGPLKKGPW TSAEDAILVE YVTKHGEGNW 60 NAVQKHSGLA RCGKSCRLRW ANHLRPDLKK GAFTADEERR IIELHAKMGN KWARMAAEVC 120 TSCRLCFLFQ QIKHTFKDIC SVALQYYIFL SYI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 6e-21 | 35 | 116 | 25 | 105 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. May bind to the 5'-TAACAAA-3' box of alpha-amylase promoter. {ECO:0000269|PubMed:9150608}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00348 | DAP | Transfer from AT3G11440 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By gibberellin in aleurone cells. {ECO:0000269|PubMed:9150608}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027179014.1 | 1e-69 | transcription factor GAMYB-like | ||||
Swissprot | A2WW87 | 2e-54 | GAM1_ORYSI; Transcription factor GAMYB | ||||
TrEMBL | A0A068UQ74 | 3e-68 | A0A068UQ74_COFCA; Uncharacterized protein | ||||
STRING | Migut.N02411.1.p | 5e-64 | (Erythranthe guttata) |