PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_86624_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family NF-YC
Protein Properties Length: 138aa    MW: 15787 Da    PI: 9.9355
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_86624_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC52.21.4e-1611100997
                                NF-YC   9 qiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaa 82 
                                          +++ a++ ++ e+P  rikki+k d++++++s+ea  l+s + elfi  l+ +s   a e+k++t+k   +  a
  cra_locus_86624_iso_1_len_438_ver_3  11 EVQIAEETHQPEIPTGRIKKIMKIDKEINRVSSEALYLISCSTELFIQFLAEKSARVALEKKKKTIKLEHLRVA 84 
                                          455667778999************************************************************** PP

                                NF-YC  83 vtrtd.ifdflvdivp 97 
                                          v+r + + dfl+d  p
  cra_locus_86624_iso_1_len_438_ver_3  85 VKRHQpTSDFLLDSLP 100
                                          *9976489*****987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.3E-201886IPR009072Histone-fold
SuperFamilySSF471134.94E-1822100IPR009072Histone-fold
PfamPF008085.1E-192285IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
XLNLAMAENE EVQIAEETHQ PEIPTGRIKK IMKIDKEINR VSSEALYLIS CSTELFIQFL  60
AEKSARVALE KKKKTIKLEH LRVAVKRHQP TSDFLLDSLP VPSQPSDQHP KDRLRLRPEN  120
KPAPAGTRRI DAFFNKCT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027154518.12e-65dr1-associated corepressor
TrEMBLA0A068V0C82e-64A0A068V0C8_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000748412e-58(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114352425