PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_8500_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family NF-YC
Protein Properties Length: 341aa    MW: 37951.7 Da    PI: 6.7276
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_8500_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC177.31.5e-551472511102
                                NF-YC   1 qlksfwekq...iekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkr 71 
                                          ql++fw++q   ie++tdfknh+lPlarikki+kadedv+misaeaP++++kace+fileltlrsw+h+eenkr
  cra_locus_8500_iso_3_len_1190_ver_3 147 QLQAFWANQvqeIEQTTDFKNHSLPLARIKKIMKADEDVRMISAEAPIVFAKACEMFILELTLRSWIHTEENKR 220
                                          89******99999************************************************************* PP

                                NF-YC  72 rtlkksdiaaavtrtdifdflvdivprdelk 102
                                          rtl+k+diaaa++rtd+fdflvdi+prdelk
  cra_locus_8500_iso_3_len_1190_ver_3 221 RTLQKNDIAAAISRTDVFDFLVDIIPRDELK 251
                                          ****************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471134.53E-33132241IPR009072Histone-fold
Gene3DG3DSA:1.10.20.104.3E-37161233IPR009072Histone-fold
PfamPF008085.3E-21169232IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
XRWFFTPPVS SRHVNTRQLS PGLAVRHVSQ GLGVPWRILE LIDDYGIQLT ASWAQSRVKR  60
VLLSETMDQS DRTQQQQQQQ QQLVGAVTSG TAVSYTNSPY QNAGMMVTGT PAAAVSSPTQ  120
PQTGFPASQH QLAYPQAQHF HSQQQQQLQA FWANQVQEIE QTTDFKNHSL PLARIKKIMK  180
ADEDVRMISA EAPIVFAKAC EMFILELTLR SWIHTEENKR RTLQKNDIAA AISRTDVFDF  240
LVDIIPRDEL KEEGLGVTKA TIPLVGSPAD SIPPYYYVPP PPPPPPQHPV GPTGMIMGKP  300
IDQAALYAGQ QLRAPPSFMP WPSQSQTQPP PPESQTQESE T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_B5e-56155247395NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1219225RRTLQKN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021592144.11e-123nuclear transcription factor Y subunit C-2-like
TrEMBLA0A2C9UIQ91e-122A0A2C9UIQ9_MANES; Uncharacterized protein
STRINGcassava4.1_014024m1e-123(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34222447