PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_8500_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family NF-YC
Protein Properties Length: 274aa    MW: 30326.2 Da    PI: 5.2869
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_8500_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC177.99.6e-56811851102
                                NF-YC   1 qlksfwekq...iekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkr 71 
                                          ql++fw++q   ie++tdfknh+lPlarikki+kadedv+misaeaP++++kace+fileltlrsw+h+eenkr
  cra_locus_8500_iso_2_len_1299_ver_3  81 QLQAFWANQvqeIEQTTDFKNHSLPLARIKKIMKADEDVRMISAEAPIVFAKACEMFILELTLRSWIHTEENKR 154
                                          89******99999************************************************************* PP

                                NF-YC  72 rtlkksdiaaavtrtdifdflvdivprdelk 102
                                          rtl+k+diaaa++rtd+fdflvdi+prdelk
  cra_locus_8500_iso_2_len_1299_ver_3 155 RTLQKNDIAAAISRTDVFDFLVDIIPRDELK 185
                                          ****************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471132.51E-3363175IPR009072Histone-fold
Gene3DG3DSA:1.10.20.102.9E-3795167IPR009072Histone-fold
PfamPF008083.7E-21103166IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MDQSDRTQQQ QQQQQQLVGA VTSGTAVSYT NSPYQNAGMM VTGTPAAAVS SPTQPQTGFP  60
ASQHQLAYPQ AQHFHSQQQQ QLQAFWANQV QEIEQTTDFK NHSLPLARIK KIMKADEDVR  120
MISAEAPIVF AKACEMFILE LTLRSWIHTE ENKRRTLQKN DIAAAISRTD VFDFLVDIIP  180
RDELKEEGLG VTKATIPLVG SPADSIPPYY YVPPPPPPPQ HPVGPTGMIM GKPIDQAALY  240
AGQQLRAPPS FMPWPSQSQT QPPPPESQTQ ESET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_B6e-5989181395NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1153159RRTLQKN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021592144.11e-125nuclear transcription factor Y subunit C-2-like
TrEMBLA0A2C9UIQ91e-124A0A2C9UIQ9_MANES; Uncharacterized protein
STRINGcassava4.1_014024m1e-124(Manihot esculenta)