PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_8025_iso_2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 112aa MW: 12936.7 Da PI: 11.1084 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 135.7 | 5.7e-42 | 10 | 83 | 96 | 170 |
YABBY 96 vsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 +++ + +++ ++++ v+rPPekrqrvPsayn+fikeeiqrika+nPdishreafs+aaknWahfP+ihfgl cra_locus_8025_iso_2_len_930_ver_3 10 NKM-AMRSSNIPKTTEERIVNRPPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGL 83 222.3333333334445669*****************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 2.4E-40 | 5 | 83 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 1.18E-8 | 25 | 76 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 4.7E-5 | 30 | 77 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
GO:1902183 | Biological Process | regulation of shoot apical meristem development | ||||
GO:2000024 | Biological Process | regulation of leaf development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 112 aa Download sequence Send to blast |
MGSSSSRCNN KMAMRSSNIP KTTEERIVNR PPEKRQRVPS AYNQFIKEEI QRIKANNPDI 60 SHREAFSTAA KNWAHFPHIH FGLMLETNNQ PKLGHDQGSE KHRMPRAAFL KK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028084904.1 | 4e-58 | axial regulator YABBY 5-like isoform X1 | ||||
Swissprot | Q8GW46 | 3e-45 | YAB5_ARATH; Axial regulator YABBY 5 | ||||
TrEMBL | A0A2N9IX36 | 3e-57 | A0A2N9IX36_FAGSY; Uncharacterized protein | ||||
STRING | VIT_11s0016g05590.t01 | 2e-57 | (Vitis vinifera) |
Publications ? help Back to Top | |||
---|---|---|---|
|