PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_79238_iso_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 106aa MW: 12363.8 Da PI: 5.1901 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 100.4 | 2.7e-31 | 2 | 100 | 247 | 345 |
GRAS 247 dhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerle 320 ++n+++F +rf+e+l+yy+a+f+s++a r+++ ri+ E++++++++vn++aceg er+erhe ++kWr rl+ cra_locus_79238_iso_1_len_316_ver_3 2 NTNTGTFYQRFCETLDYYTAMFESIDAARERDDRLRISSEEHCVAKDVVNIIACEGIERVERHELFGKWRLRLM 75 78**************************9********************************************* PP GRAS 321 eaGFkpvplsekaakqaklllrkvk 345 +aGF+pv+ls ++ + +k +l++++ cra_locus_79238_iso_1_len_316_ver_3 76 MAGFSPVQLSPSVSNVVKEVLKEFS 100 *********************9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 21.335 | 1 | 106 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 9.4E-29 | 2 | 100 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 106 aa Download sequence Send to blast |
SNTNTGTFYQ RFCETLDYYT AMFESIDAAR ERDDRLRISS EEHCVAKDVV NIIACEGIER 60 VERHELFGKW RLRLMMAGFS PVQLSPSVSN VVKEVLKEFS PNFWMX |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011095941.1 | 3e-56 | scarecrow-like protein 13 | ||||
Swissprot | Q9M0M5 | 5e-41 | SCL13_ARATH; Scarecrow-like protein 13 | ||||
TrEMBL | A0A022QK74 | 5e-52 | A0A022QK74_ERYGU; Uncharacterized protein | ||||
STRING | Migut.M01421.1.p | 8e-53 | (Erythranthe guttata) |