PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_77219_iso_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 112aa MW: 13012 Da PI: 11.1583 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 30.4 | 9.1e-10 | 6 | 35 | 19 | 48 |
TTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 19 lGggtWktIartmgkgRtlkqcksrwqkyl 48 +G g W++ ar g++Rt+k+c++rw++yl cra_locus_77219_iso_1_len_332_ver_3 6 HGEGVWNSLARSAGLKRTGKSCRLRWLNYL 35 999**************************7 PP | |||||||
2 | Myb_DNA-binding | 55.7 | 1.2e-17 | 41 | 84 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+eE++l+ ++++++G++ W++Ia++++ gRt++++k++w++ cra_locus_77219_iso_1_len_332_ver_3 41 RGNITPEEQLLIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNFWRT 84 8999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 7.283 | 1 | 35 | IPR017930 | Myb domain |
SMART | SM00717 | 30 | 2 | 37 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-14 | 5 | 42 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.08E-4 | 6 | 35 | No hit | No description |
Pfam | PF00249 | 8.5E-8 | 6 | 35 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 5.01E-23 | 21 | 93 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.831 | 36 | 90 | IPR017930 | Myb domain |
SMART | SM00717 | 3.4E-15 | 40 | 88 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-16 | 41 | 84 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-25 | 43 | 91 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.33E-12 | 45 | 84 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009740 | Biological Process | gibberellic acid mediated signaling pathway | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0080086 | Biological Process | stamen filament development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 112 aa Download sequence Send to blast |
XGRGNHGEGV WNSLARSAGL KRTGKSCRLR WLNYLRPDVR RGNITPEEQL LIMELHAKWG 60 NRWSKIAKHL PGRTDNEIKN FWRTRIQKHM KQGDDSNFNG QNDNHSNDQA SX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-18 | 6 | 90 | 25 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011468270.1 | 2e-65 | PREDICTED: myb-related protein 305-like | ||||
Refseq | XP_024179357.1 | 1e-65 | myb-related protein 305-like | ||||
Swissprot | P81391 | 2e-62 | MYB05_ANTMA; Myb-related protein 305 | ||||
TrEMBL | A0A2P6S5K0 | 3e-64 | A0A2P6S5K0_ROSCH; Putative transcription factor MYB-HB-like family | ||||
STRING | XP_004304632.1 | 8e-65 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Publications ? help Back to Top | |||
---|---|---|---|
|