PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_76806_iso_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 103aa MW: 11549 Da PI: 10.4695 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 73 | 5.1e-23 | 43 | 102 | 1 | 60 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsat 60 s++k+kaal+ ++v+p+f +l+sg +kl+r G+++l++ +a++er+ydW+k+q+falsat cra_locus_76806_iso_1_len_308_ver_3 43 SIFKGKAALSAEPVMPKFIKLESGGFKLERCGTIMLTFWPAIGERRYDWDKRQKFALSAT 102 79********************************************************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 1.0E-27 | 32 | 102 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 5.96E-24 | 37 | 102 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 3.1E-21 | 44 | 102 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
LFGESTNNSK LWRGMTTQTN ISTANPNLSR YGESAAKVFA PYSIFKGKAA LSAEPVMPKF 60 IKLESGGFKL ERCGTIMLTF WPAIGERRYD WDKRQKFALS ATX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3n1h_A | 9e-32 | 32 | 102 | 5 | 75 | StWhy2 |
3n1i_A | 9e-32 | 32 | 102 | 5 | 75 | protein StWhy2 |
3n1j_A | 9e-32 | 32 | 102 | 5 | 75 | Protein StWhy2 |
3n1k_A | 9e-32 | 32 | 102 | 5 | 75 | protein StWhy2 |
3n1l_A | 9e-32 | 32 | 102 | 5 | 75 | protein StWhy2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011095185.1 | 1e-43 | single-stranded DNA-bindig protein WHY2, mitochondrial isoform X2 | ||||
Swissprot | D9J034 | 5e-32 | WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
TrEMBL | A0A022Q835 | 1e-41 | A0A022Q835_ERYGU; Uncharacterized protein | ||||
STRING | Migut.C01402.1.p | 2e-42 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA9782 | 22 | 28 |