PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_73018_iso_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 160aa MW: 18416.3 Da PI: 6.9353 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.5 | 2.8e-17 | 24 | 65 | 4 | 47 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 T+ E++l +d++++lG++ W++Ia++++ gRt++++k++w+++ cra_locus_73018_iso_1_len_478_ver_3 24 LTEVEEQLVIDLHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 65 699****************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 4.612 | 1 | 15 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 5.7E-5 | 2 | 14 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 4.61E-21 | 2 | 75 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 4.1E-25 | 15 | 71 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 26.638 | 16 | 70 | IPR017930 | Myb domain |
SMART | SM00717 | 3.3E-15 | 20 | 68 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.7E-15 | 23 | 65 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.31E-12 | 25 | 66 | No hit | No description |
PROSITE pattern | PS00157 | 0 | 91 | 99 | IPR020878 | Ribulose bisphosphate carboxylase, large chain, active site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0015977 | Biological Process | carbon fixation | ||||
GO:0000287 | Molecular Function | magnesium ion binding | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0016984 | Molecular Function | ribulose-bisphosphate carboxylase activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 160 aa Download sequence Send to blast |
RRCGKSCRLR WTNYLRPDLK RGLLTEVEEQ LVIDLHARLG NRWSKIAARL PGRTDNEIKN 60 HWNTHIKKKL VKMGIDPVTH EPLRNEKSEG GDDFDKDDEM QQPKPNSTAS SKQSSCSPTD 120 QNNNSSGESN WKLYENDPLI NSLFGEDFPQ VDIPWEIPSX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-21 | 2 | 70 | 40 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269|PubMed:15805488}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027182988.1 | 2e-65 | protein ODORANT1 | ||||
Swissprot | Q50EX6 | 1e-57 | ODO1_PETHY; Protein ODORANT1 | ||||
TrEMBL | A0A059PRE2 | 3e-68 | A0A059PRE2_SALMI; MYB-related transcription factor | ||||
STRING | Migut.A00867.1.p | 1e-62 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Publications ? help Back to Top | |||
---|---|---|---|
|