PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_7133_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family GRAS
Protein Properties Length: 620aa    MW: 67408.8 Da    PI: 5.2405
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_7133_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS456.81.4e-1392456181374
                                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekns 74 
                                          lv++L++cAea+++++l+ a+al+++++ la +++ +m+++a+yf+eALa+r++r        l p++ +++ s
  cra_locus_7133_iso_1_len_2098_ver_3 245 LVHTLMACAEAIQQENLKVAEALVKQIRFLAVSQAGAMRKVATYFAEALARRIYR--------LYPTNPHDSAS 310
                                          689****************************************************........44555554456 PP

                                 GRAS  75 seelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvg 148
                                          ++ l++   f+e++P+lkf+h+taNqaIlea+++++rvH+iDf+i+qGlQWpaLlqaLa Rp+gpps+R+Tg+g
  cra_locus_7133_iso_1_len_2098_ver_3 311 TDLLQM--HFYETCPYLKFAHFTANQAILEAFANKNRVHVIDFSIKQGLQWPALLQALALRPGGPPSFRLTGIG 382
                                          666555..5***************************************************************** PP

                                 GRAS 149 spesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles 222
                                          +p++++++ l+e+g++La++Ae+++v+fe++ +va++l+dl+ +++++++gE++aVn++++lh+ll++++++++
  cra_locus_7133_iso_1_len_2098_ver_3 383 PPSHDNTDHLQEVGWKLAQLAETINVEFEYRGFVANSLADLDASMFDIREGETVAVNSIFELHQLLARQGAIDK 456
                                          ******************************************************************88888888 PP

                                 GRAS 223 erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak.............lpreseeri 283
                                              vL++vk+l+P++++vveqea+hn++ F++rf e+l+yys+lfdsle                ++ +++++
  cra_locus_7133_iso_1_len_2098_ver_3 457 ----VLSVVKELKPEIMTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGCgnggagggeggasCGSPTDQDK 526
                                          ....*********************************************98889*********88888889*** PP

                                 GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesg 356
                                          ++++ +lgr+i+nvvaceg +r+erhetl +W+ r+++aGF +v+l+++a kqa++ll+ ++ +dgyrvee++g
  cra_locus_7133_iso_1_len_2098_ver_3 527 VMSELYLGRQICNVVACEGVDRVERHETLTQWKTRFNSAGFAAVHLGSNAFKQASMLLALFAgGDGYRVEENNG 600
                                          ************************************************************************** PP

                                 GRAS 357 slvlgWkdrpLvsvSaWr 374
                                          +l+lgW++rpL+++SaW+
  cra_locus_7133_iso_1_len_2098_ver_3 601 CLMLGWHTRPLIATSAWK 618
                                          *****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512577129No hitNo description
PfamPF120412.2E-3554120IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011291.3E-3554127No hitNo description
PROSITE profilePS5098566.925219597IPR005202Transcription factor GRAS
PfamPF035144.7E-137245618IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006808Biological Processregulation of nitrogen utilization
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0010233Biological Processphloem transport
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MKRDHTKTQA AAQESFPGGG GSSTASGSCY TMGSSTSGMA KMWKDTVKQD AGDDELLAVL  60
GYKVKSSDMA EVAQKIEQLE EFMGNVQQDG LSHLASDTVH YNPSDLYSWL ESMISEINPD  120
GSSLPDSSTI TSLDNSSSTN TSQNNRGLSN GVLVFDDSSF DSDLTAIPGN AVYPQIHPSP  180
PPTRLQPPSS SAQPPVVQPP NKRMKPNSQM GVFGIPNESV LPIARPMDST RPVVLVDSQE  240
NGIRLVHTLM ACAEAIQQEN LKVAEALVKQ IRFLAVSQAG AMRKVATYFA EALARRIYRL  300
YPTNPHDSAS TDLLQMHFYE TCPYLKFAHF TANQAILEAF ANKNRVHVID FSIKQGLQWP  360
ALLQALALRP GGPPSFRLTG IGPPSHDNTD HLQEVGWKLA QLAETINVEF EYRGFVANSL  420
ADLDASMFDI REGETVAVNS IFELHQLLAR QGAIDKVLSV VKELKPEIMT VVEQEANHNG  480
PVFMDRFNES LHYYSTLFDS LEGCGNGGAG GGEGGASCGS PTDQDKVMSE LYLGRQICNV  540
VACEGVDRVE RHETLTQWKT RFNSAGFAAV HLGSNAFKQA SMLLALFAGG DGYRVEENNG  600
CLMLGWHTRP LIATSAWKLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A2e-6824061713377Protein SCARECROW
5b3h_D2e-6824061713377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027100221.10.0DELLA protein GAI1-like
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLA0A2G9HQV20.0A0A2G9HQV2_9LAMI; Uncharacterized protein
STRINGXP_009789076.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462