PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_7074_iso_3

Common Name

RR5

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

ARR-B

Protein Properties

Length: 329aa MW: 36796.6 Da PI: 6.6315

Description

ARR-B family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_7074_iso_3	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	92.7	3e-29	218	271	1	55
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl cra_locus_7074_iso_3_len_1280_ver_3 218 KPRVVWSVELHQQFVAAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 271 79*****************.******************************8 PP
2	Response_reg	78.2	2.8e-26	38	146	1	109
EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTS CS Response_reg 1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepkl 72 vl+vdD+p+ +++l+++l++ y ev+ + +e al+ll++++ +D+++ D+ mp+mdG++ll++ e +l cra_locus_7074_iso_3_len_1280_ver_3 38 VLVVDDDPTCLRILEKMLKNCLY-EVTKCNRAEIALKLLRDNRngYDIVISDVHMPDMDGFKLLEQVGLEM-DL 109 89*******************.***********999999*******************6644.8 PP EEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS Response_reg 73 piivvtahgeeedalealkaGakdflsKpfdpeelvk 109 p+i+++a ++++ + + + Ga d+l Kp+ +e+l + cra_locus_7074_iso_3_len_1280_ver_3 110 PVIMMSADDSKNVVMKGVTHGACDYLIKPVRIEALKN 146 *********************************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF036392	1.3E-175	17	328	IPR017053	Response regulator B-type, plant
SuperFamily	SSF52172	1.71E-35	35	160	IPR011006	CheY-like superfamily
Gene3D	G3DSA:3.40.50.2300	1.1E-42	35	178	No hit	No description
SMART	SM00448	6.4E-30	36	148	IPR001789	Signal transduction response regulator, receiver domain
PROSITE profile	PS50110	41.725	37	152	IPR001789	Signal transduction response regulator, receiver domain
Pfam	PF00072	1.6E-23	38	146	IPR001789	Signal transduction response regulator, receiver domain
CDD	cd00156	5.54E-28	39	151	No hit	No description
SuperFamily	SSF46689	1.18E-20	215	275	IPR009057	Homeodomain-like
PROSITE profile	PS51294	11.048	215	274	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	8.7E-31	217	276	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	3.5E-25	218	271	IPR006447	Myb domain, plants
Pfam	PF00249	3.6E-8	220	270	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000160	Biological Process	phosphorelay signal transduction system
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009414	Biological Process	response to water deprivation
GO:0010082	Biological Process	regulation of root meristem growth
GO:0010380	Biological Process	regulation of chlorophyll biosynthetic process
GO:0031537	Biological Process	regulation of anthocyanin metabolic process
GO:0048367	Biological Process	shoot system development
GO:0080022	Biological Process	primary root development
GO:0080036	Biological Process	regulation of cytokinin-activated signaling pathway
GO:0080113	Biological Process	regulation of seed growth
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 329 aa Download sequence Send to blast
MNLGGGQLVK SMAVPSSSAS WKSGGDGVSD QFPAGLRVLV VDDDPTCLRI LEKMLKNCLY 60 EVTKCNRAEI ALKLLRDNRN GYDIVISDVH MPDMDGFKLL EQVGLEMDLP VIMMSADDSK 120 NVVMKGVTHG ACDYLIKPVR IEALKNIWQH VVRKRKHEWK EKDYEQSGSV EDGERQQKPN 180 EDVDYSSSAN EGNWKNSKKR KDDEEDQEEK DDSSTLKKPR VVWSVELHQQ FVAAVNQLGI 240 DKAVPKKILE LMNVPGLTRE NVASHLQKYR LYLRRVSGVS QHQNGLNNSF MGTPDATFGS 300 MSSINGLDFQ ALAATGQIPA QCLWXIKGT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1irz_A	3e-23	217	277	4	64	ARR10-B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Regulates SHY2 by binding to its promoter (PubMed:19039136). Involved in the root-meristem size determination through the regulation of cell differentiation (PubMed:17363254). {ECO:0000269\|PubMed:11574878, ECO:0000269\|PubMed:11691951, ECO:0000269\|PubMed:17363254, ECO:0000269\|PubMed:19039136}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by gibberellin. {ECO:0000269\|PubMed:20605455}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011100812.1	0.0	two-component response regulator ARR2 isoform X1
Refseq	XP_011100813.1	0.0	two-component response regulator ARR2 isoform X2
Refseq	XP_011100814.1	0.0	two-component response regulator ARR2 isoform X3
Swissprot	Q940D0	1e-159	ARR1_ARATH; Two-component response regulator ARR1
TrEMBL	Q71BZ1	0.0	Q71BZ1_CATRO; Two-component response regulator
STRING	Solyc05g054390.2.1	0.0	(Solanum lycopersicum)

Publications ? help Back to Top
Papon N, et al. Inhibition of the plant cytokinin transduction pathway by bacterial histidine kinase inhibitors in Catharanthus roseus cell cultures. FEBS Lett., 2003. 537(1-3): p. 101-5 [PMID:12606039] Bürkle L,Meyer S,Dortay H,Lehrach H,Heyl A In vitro recombination cloning of entire cDNA libraries in Arabidopsis thaliana and its application to the yeast two-hybrid system. Funct. Integr. Genomics, 2005. 5(3): p. 175-83 [PMID:15714319] Moubayidin L, et al. Spatial coordination between stem cell activity and cell differentiation in the root meristem. Dev. Cell, 2013. 26(4): p. 405-15 [PMID:23987513] Takahashi N, et al. Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots. Curr. Biol., 2013. 23(18): p. 1812-7 [PMID:24035544] Kurepa J,Li Y,Perry SE,Smalle JA Ectopic expression of the phosphomimic mutant version of Arabidopsis response regulator 1 promotes a constitutive cytokinin response phenotype. BMC Plant Biol., 2014. 14: p. 28 [PMID:24423196] Cortleven A, et al. A novel protective function for cytokinin in the light stress response is mediated by the Arabidopsis histidine kinase2 and Arabidopsis histidine kinase3 receptors. Plant Physiol., 2014. 164(3): p. 1470-83 [PMID:24424319] Marín-de la Rosa N, et al. Genome Wide Binding Site Analysis Reveals Transcriptional Coactivation of Cytokinin-Responsive Genes by DELLA Proteins. PLoS Genet., 2015. 11(7): p. e1005337 [PMID:26134422] D'Alessandro S,Golin S,Hardtke CS,Lo Schiavo F,Zottini M The co-chaperone p23 controls root development through the modulation of auxin distribution in the Arabidopsis root meristem. J. Exp. Bot., 2015. 66(16): p. 5113-22 [PMID:26163704] Jiang L, et al. Strigolactones spatially influence lateral root development through the cytokinin signaling network. J. Exp. Bot., 2016. 67(1): p. 379-89 [PMID:26519957] Moubayidin L, et al. A SCARECROW-based regulatory circuit controls Arabidopsis thaliana meristem size from the root endodermis. Planta, 2016. 243(5): p. 1159-68 [PMID:26848984] Muraro D, et al. A multi-scale model of the interplay between cell signalling and hormone transport in specifying the root meristem of Arabidopsis thaliana. J. Theor. Biol., 2016. 404: p. 182-205 [PMID:27157127] Cortleven A, et al. Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes. Plant Physiol., 2016. 172(1): p. 464-78 [PMID:27388681] Kobayashi K, et al. Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling. Plant Physiol., 2017. 173(4): p. 2340-2355 [PMID:28193764] Zhang TQ, et al. A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration. Plant Cell, 2017. 29(5): p. 1073-1087 [PMID:28389585] Kushwah S,Laxmi A The interaction between glucose and cytokinin signaling in controlling Arabidopsis thaliana seedling root growth and development. Plant Signal Behav, 2017. 12(5): p. e1312241 [PMID:28467152] Meng WJ, et al. Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL. Plant Cell, 2017. 29(6): p. 1357-1372 [PMID:28576846] Kobayashi K,Iwase A Simultaneous but spatially different regulation of non-photosynthetic callus formation and photosynthetic root development after shoot removal. Plant Signal Behav, 2017. 12(6): p. e1338999 [PMID:28594268] Liu B,De Storme N,Geelen D Cold interferes with male meiotic cytokinesis in Arabidopsis thaliana independently of the AHK2/3-AHP2/3/5 cytokinin signaling module. Cell Biol. Int., 2017. 41(8): p. 879-889 [PMID:28618065] Zhang F,May A,Irish VF Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL. Trends Plant Sci., 2017. 22(10): p. 815-817 [PMID:28886911] Yan Z, et al. Type B Response Regulators Act As Central Integrators in Transcriptional Control of the Auxin Biosynthesis Enzyme TAA1. Plant Physiol., 2017. 175(3): p. 1438-1454 [PMID:28931628] Rong XF, et al. Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis. Plant Cell Physiol., 2018. 59(4): p. 756-764 [PMID:29186581] Bustillo-Avendaño E, et al. Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis. Plant Physiol., 2018. 176(2): p. 1709-1727 [PMID:29233938] Waldie T,Leyser O Cytokinin Targets Auxin Transport to Promote Shoot Branching. Plant Physiol., 2018. 177(2): p. 803-818 [PMID:29717021]