PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_70089_iso_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 93aa MW: 10678.3 Da PI: 8.1899 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 183.2 | 2.1e-57 | 2 | 93 | 2 | 93 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfe 77 +eqdrflPianvsrimkk+lPanakiskdaketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfe cra_locus_70089_iso_1_len_279_ver_3 2 KEQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFE 77 89************************************************************************** PP NF-YB 78 dyveplkvylkkyrel 93 +yveplkvyl+kyre+ cra_locus_70089_iso_1_len_279_ver_3 78 EYVEPLKVYLAKYREM 93 **************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.1E-52 | 2 | 93 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.17E-39 | 4 | 93 | IPR009072 | Histone-fold |
Pfam | PF00808 | 9.6E-29 | 7 | 71 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 5.0E-22 | 35 | 53 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 38 | 54 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 5.0E-22 | 54 | 72 | No hit | No description |
PRINTS | PR00615 | 5.0E-22 | 73 | 91 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 93 aa Download sequence Send to blast |
SKEQDRFLPI ANVSRIMKKA LPANAKISKD AKETVQECVS EFISFVTGEA SDKCQREKRK 60 TINGDDLLWA MTTLGFEEYV EPLKVYLAKY REM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-48 | 2 | 92 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-48 | 2 | 92 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011100345.1 | 6e-66 | nuclear transcription factor Y subunit B-3 | ||||
Swissprot | O23310 | 6e-62 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A2G9HCD2 | 1e-63 | A0A2G9HCD2_9LAMI; CCAAT-binding factor, subunit A (HAP3) | ||||
STRING | XP_009622977.1 | 3e-62 | (Nicotiana tomentosiformis) | ||||
STRING | XP_004305679.1 | 4e-62 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Publications ? help Back to Top | |||
---|---|---|---|
|