PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_69402_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family YABBY
Protein Properties Length: 87aa    MW: 9557.62 Da    PI: 10.5434
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_69402_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY991e-301370106163
                                YABBY 106 deevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163
                                          + ++p++p v++PPek+ r Psaynrf+k+eiqrika+nP+i hreafsaaaknWa +
  cra_locus_69402_iso_1_len_287_ver_3  13 EPSSPKAPFVVKPPEKKHRLPSAYNRFMKDEIQRIKAANPEIPHREAFSAAAKNWARY 70 
                                          456899999***********************************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046906.5E-301470IPR006780YABBY protein
SuperFamilySSF470951.15E-91469IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.109.3E-62469IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
ASCXTALPIS SSEPSSPKAP FVVKPPEKKH RLPSAYNRFM KDEIQRIKAA NPEIPHREAF  60
SAAAKNWARY IPNTPQGPPP ASSNNNM
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for the initiation of nectary development. Also involved in suppressing early radial growth of the gynoecium, in promoting its later elongation and in fusion of its carpels by regulating both cell division and expansion. Establishes the polar differentiation in the carpels by specifying abaxial cell fate in the ovary wall. Regulates both cell division and expansion. {ECO:0000269|PubMed:10225997, ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:10535738, ECO:0000269|PubMed:11714690, ECO:0000269|PubMed:15598802, ECO:0000269|Ref.10}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by SPT and by A class genes AP2 and LUG in the outer whorl. In the third whorl, B class genes AP3 and PI, and the C class gene AG act redundantly with each other and in combination with SEP1, SEP2, SEP3, SHP1 and SHP2 to activate CRC in nectaries and carpels. LFY enhances its expression. {ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:15598802}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016505118.11e-41PREDICTED: protein CRABS CLAW-like, partial
SwissprotQ8L9251e-31CRC_ARATH; Protein CRABS CLAW
TrEMBLA0A1S4CVI43e-40A0A1S4CVI4_TOBAC; protein CRABS CLAW-like
STRINGVIT_01s0011g00140.t012e-38(Vitis vinifera)
STRINGXP_009600446.14e-38(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52102339
Publications ? help Back to Top
  1. Fourquin C,Primo A,Martínez-Fernández I,Huet-Trujillo E,Ferrándiz C
    The CRC orthologue from Pisum sativum shows conserved functions in carpel morphogenesis and vascular development.
    Ann. Bot., 2014. 114(7): p. 1535-44
    [PMID:24989787]
  2. Pfannebecker KC,Lange M,Rupp O,Becker A
    Seed Plant-Specific Gene Lineages Involved in Carpel Development.
    Mol. Biol. Evol., 2017. 34(4): p. 925-942
    [PMID:28087776]
  3. Yamaguchi N,Huang J,Xu Y,Tanoi K,Ito T
    Fine-tuning of auxin homeostasis governs the transition from floral stem cell maintenance to gynoecium formation.
    Nat Commun, 2017. 8(1): p. 1125
    [PMID:29066759]
  4. Yamaguchi N, et al.
    Chromatin-mediated feed-forward auxin biosynthesis in floral meristem determinacy.
    Nat Commun, 2018. 9(1): p. 5290
    [PMID:30538233]