PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_59851_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family NF-YC
Protein Properties Length: 271aa    MW: 30284.7 Da    PI: 6.6044
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_59851_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC174.89e-55581611101
                                NF-YC   1 qlksfwekq...iekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkr 71 
                                          ql++fw++q   ie ++dfknh+lPlarikki+kadedv+misaeaPv++++ace+fileltlr+w+h+eenkr
  cra_locus_59851_iso_1_len_872_ver_3  58 QLQNFWANQyqeIELVNDFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEMFILELTLRAWNHTEENKR 131
                                          89******9989999*********************************************************** PP

                                NF-YC  72 rtlkksdiaaavtrtdifdflvdivprdel 101
                                          rtl+k+diaaa+trtdifdflvdivpr++l
  cra_locus_59851_iso_1_len_872_ver_3 132 RTLQKNDIAAAITRTDIFDFLVDIVPREDL 161
                                          ***************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471134.35E-3448152IPR009072Histone-fold
PfamPF008082.8E-2280143IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.103.0E-3881158IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
XPMLYGAPYH ANQMAGPSLP VSTGAQTVGL PASSGQMAQH QLAYQHIHQQ QQQQLQQQLQ  60
NFWANQYQEI ELVNDFKNHS LPLARIKKIM KADEDVRMIS AEAPVVFARA CEMFILELTL  120
RAWNHTEENK RRTLQKNDIA AAITRTDIFD FLVDIVPRED LKDEVLASIP RGTLPVGGPT  180
EGLPFYYGMP PQSAPPVGAS GMYMGKPVDQ ALYAQQPRPY MAQPIWPQQQ PPPSNSXAAQ  240
SIDYSIPEAG AESSRSSKYW RTHHSDSSLH T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_B9e-6066158395NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130136RRTLQKN
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Interacts with REF6 to directly regulate SOC1 transcription in response to flowering signals from photoperiod and gibberellic acid pathways (PubMed:25105952). {ECO:0000250, ECO:0000269|PubMed:25105952}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019263801.11e-139PREDICTED: nuclear transcription factor Y subunit C-9-like isoform X1
SwissprotQ8L4B27e-83NFYC9_ARATH; Nuclear transcription factor Y subunit C-9
TrEMBLA0A314L5H71e-138A0A314L5H7_NICAT; Nuclear transcription factor y subunit c-9
STRINGXP_009590081.11e-138(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34222447
Publications ? help Back to Top
  1. Hwang YH, et al.
    Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time.
    Plant Cell Rep., 2016. 35(4): p. 857-65
    [PMID:26754793]
  2. Liu X, et al.
    The NF-YC-RGL2 module integrates GA and ABA signalling to regulate seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 12768
    [PMID:27624486]
  3. Myers ZA, et al.
    NUCLEAR FACTOR Y, Subunit C (NF-YC) Transcription Factors Are Positive Regulators of Photomorphogenesis in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(9): p. e1006333
    [PMID:27685091]
  4. Tang Y, et al.
    Arabidopsis NF-YCs Mediate the Light-Controlled Hypocotyl Elongation via Modulating Histone Acetylation.
    Mol Plant, 2017. 10(2): p. 260-273
    [PMID:27876642]
  5. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  6. Gnesutta N, et al.
    CONSTANS Imparts DNA Sequence Specificity to the Histone Fold NF-YB/NF-YC Dimer.
    Plant Cell, 2017. 29(6): p. 1516-1532
    [PMID:28526714]
  7. Bi C,Ma Y,Wang XF,Zhang DP
    Overexpression of the transcription factor NF-YC9 confers abscisic acid hypersensitivity in Arabidopsis.
    Plant Mol. Biol., 2017. 95(4-5): p. 425-439
    [PMID:28924726]
  8. Liu X, et al.
    Temporal-Specific Interaction of NF-YC and CURLY LEAF during the Floral Transition Regulates Flowering.
    Plant Physiol., 2018. 177(1): p. 105-114
    [PMID:29599268]